SAXSdb — 8ee0

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide B synthase

Saccharopolyspora erythraea

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	1B2 antibody light chain × 2 1B2 antibody heavy chain × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q5UNP6_SACER
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 33–921； UniProt 2033–2921

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ee0
Deposition date deposition_date	2022-09-06
Structure title title	KS-AT didomain from module 2 of the 6-deoxyerythronolide B synthase in complex with antibody fragment 1B2
Keywords keywords	polyketide synthase, BIOSYNTHETIC PROTEIN, TRANSFERASE-IMMUNE SYSTEM complex; BIOSYNTHETIC PROTEIN, TRANSFERASE/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ee0__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ee0__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ee0__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.60 Å
Rg (electron density)	49.91 Å
Total Rg	49.93 Å
Atom count	19184
Residues	2606
Excluded volume	338640 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ee0__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	6-deoxyerythronolide B synthase
Molecular weight formula_weight	97601.6 kDa
EC 编号 ec_number	2.3.1.94
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	9704

MASTDSEKVAEYLRRATLDLRAARQRIRELESEPIAIVGMACRLPGEVDSPERLWELITSGRDSAAEVPDDRGWVPDELMASDAAGTRRAHGNFMAGAGDFDAAFFGISPREALAMDPQQRQALETTWEALESAGIPPETLRGSDTGVFVGMSHQGYATGRPRPEDGVDGYLLTGNTASVASGRIAYVLGLEGPALTVDTACSSSLVALHTACGSLRDGDCGLAVAGGVSVMAGPEVFTEFSRQGALSPDGRCKPFSDEADGFGLGEGSAFVVLQRLSDARREGRRVLGVVAGSAVNQDGASNGLSAPSGVAQQRVIRRAWARAGITGADVAVVEAHGTGTRLGDPVEASALLATYGKSRGSSGPVLLGSVKSNIGHAQAAAGVAGVIKVLLGLERGVVPPMLCRGERSGLIDWSSGEIELADGVREWSPAADGVRRAGVSAFGVSGTNAHVIIAEPPEPEPVPQPRRMLPATGVVPVVLSARTGAALRAQAGRLADHLAAHPGIAPADVSWTMARARQHFEERAAVLAADTAEAVHRLRAVADGAVVPGVVTGSASDGGSVFVFPGQGAQWEGMARELLPVPVFAESIAECDAVLSEVAGFSVSEVLEPRPDAPSLERVDVVQPVLFAVMVSLARLWRACGAVPSAVIGHSQGEIAAAVVAGALSLEDGMRVVARRSRAVRAVAGRGSMLSVRGGRSDVEKLLADDSWTGRLEVAAVNGPDAVVVAGDAQAAREFLEYCEGVGIRARAIPVDYASHTAHVEPVRDELVQALAGITPRRAEVPFFSTLTGDFLDGTELDAGYWYRNLRHPVEFHSAVQALTDQGYATFIEVSPHPVLASSVQETLDDAESDAAVLGTLERDAGDADRFLTALADAHTRGVAVDWEAVLGRAGLVDLPGYPFQGKRFWLLPDRTTPRDELDGAAALEHHHHHH

Source Source

Source organism organism	Saccharopolyspora erythraea
NCBI taxonomy ID ncbi_taxonomy_id	1836
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	1B2 antibody light chain
Molecular weight formula_weight	25715.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

LFAIPLVVPFYSHSALDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSLQTPRLTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRGAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	1B2 antibody heavy chain
Molecular weight formula_weight	26447.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAEVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRGGTLFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCAALVPRGSAHHHHHHAADYKDDDDKA

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	112

▼

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

Domain ID domain_id	8ee0A01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	47 — Peroxisomal Thiolase; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Thiolase/Chalcone synthase

Domain ID domain_id	8ee0A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	8ee0A03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	366 — Malonyl-Coenzyme A Acyl Carrier Protein; domain 2
Homologous superfamily homologous superfamily	10 — Malonyl-Coenzyme A Acyl Carrier Protein, domain 2

Domain ID domain_id	8ee0H01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	8ee0H02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	91.850 Å
Unit-cell length b length_b	91.850 Å
Unit-cell length c length_c	393.100 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	2.650 Å
Low-resolution limit resolution_low	39.660 Å
R factor r_factor	0.2129
R_work r_work	0.2107
R_free r_free	0.2542

KS-AT didomain from module 2 of the 6-deoxyerythronolide B synthase in complex with antibody fragment 1B2

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide B synthase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ee0__assembly_1__model_1

8ee0__assembly_1__model_1 | I(q)

8ee0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

7. Citations (1)

KS-AT didomain from module 2 of the 6-deoxyerythronolide B synthase in complex with antibody fragment 1B2

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide B synthase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ee0__assembly_1__model_1

8ee0__assembly_1__model_1 | I(q)

8ee0__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 5 domains

CATH v4.4 (5 domains)

7. Citations (1)