SAXSdb — 7mgx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Multidrug transporter EmrE

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	L10 Monobody × 2 1,1'-dimethyl-4,4'-bipyridin-1-ium × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	L10 Monobody × 2 1,1'-dimethyl-4,4'-bipyridin-1-ium × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EMRE_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–110； UniProt 1–110 Author chain B； PDBConstruct 1–110； UniProt 1–110 Author chain E； PDBConstruct 1–110； UniProt 1–110 Author chain F； PDBConstruct 1–110； UniProt 1–110

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7mgx
Deposition date deposition_date	2021-04-13
Structure title title	Structure of EmrE-D3 mutant in complex with monobody L10 and methyl viologen
Keywords keywords	small multidrug resistance transporter, paraquat, TRANSPORT PROTEIN, TRANSPORT PROTEIN-IMMUNE SYSTEM complex; TRANSPORT PROTEIN/IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7mgx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7mgx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7mgx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.12 Å
Rg (electron density)	27.26 Å
Total Rg	28.10 Å
Atom count	2918
Residues	380
Excluded volume	53200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7mgx__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7mgx__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Multidrug transporter EmrE
Molecular weight formula_weight	11907.3 kDa
Mutation mutation	E25N, W31I, V34M
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,E,B,F
Atom count atom_count	5836

MNPYIYLGGAILAEVIGTTLMKFSNGFTRLIPSMGTIICYCASFWLLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLLSRSTPH

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	L10 Monobody
Molecular weight formula_weight	9931.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,G,D,H

VSSVPTKLEVVAATPTSLLISWDAGHWWEWVTYYRITYGETGGNSPVQEFTVPGYSSTATISGLKPGVDYTITVYAPTSDYGSPISINYRT

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	1,1'-dimethyl-4,4'-bipyridin-1-ium
Molecular weight formula_weight	186.3 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	50.910 Å
Unit-cell length b length_b	75.070 Å
Unit-cell length c length_c	111.430 Å
Unit-cell angle α angle_alpha	92.03 °
Unit-cell angle β angle_beta	90.33 °
Unit-cell angle γ angle_gamma	109.20 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.130 Å
Low-resolution limit resolution_low	32.920 Å
R factor r_factor	0.3071
R_work r_work	0.3059
R_free r_free	0.3317

Structure of EmrE-D3 mutant in complex with monobody L10 and methyl viologen

1. Protein Identity and Related Structures Protein Identity & Related Structures

Multidrug transporter EmrE

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7mgx__assembly_1__model_1

7mgx__assembly_1__model_1 | I(q)

7mgx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

Structure of EmrE-D3 mutant in complex with monobody L10 and methyl viologen

1. Protein Identity and Related Structures Protein Identity & Related Structures

Multidrug transporter EmrE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7mgx__assembly_1__model_1

7mgx__assembly_1__model_1 | I(q)

7mgx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)