SAXSdb — 7mpg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0,Envelope glycoprotein

Human immunodeficiency virus 1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 9 PDB declaration: nonameric（9） Consistent with protein copy count	Chain A； UniProt 16–503 Chain B； UniProt 16–503 Chain C； UniProt 16–503	Mutation：S155C,S190F,V207L,S290C	AM14 Fab Heavy Chain × 3 AM14 Fab Light Chain × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A0A0X8XQD7_HRSV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–459； UniProt 16–503 Author chain B； PDBConstruct 1–459； UniProt 16–503 Author chain C； PDBConstruct 1–459； UniProt 16–503

Fusion glycoprotein F0,Envelope glycoprotein

Human immunodeficiency virus 1

UniProt M1E1E4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 9 PDB declaration: nonameric（9） Consistent with protein copy count	Chain A； UniProt 1–29 Chain B； UniProt 1–29 Chain C； UniProt 1–29	Mutation：S155C,S190F,V207L,S290C	AM14 Fab Heavy Chain × 3 AM14 Fab Light Chain × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer：pH 7 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7MPG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2M7W Independently verified structure of gp41-M-MAT, a membrane associated MPER trimer from HIV-1 gp41 Deposited 2013-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–59（59 aa） Chain B 1–59（59 aa） Chain C 1–59（59 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；303 K；Pressure ambient NMR sample composition 2 mM protein, 50 mM sodium phosphate, 100 mM [U-99% 2H] DPC, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
5KWW Crystal Structure of Inhibitor JNJ-53718678 In Complex with Prefusion RSV F Glycoprotein Deposited 2016-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa） Fragment：F0 (UNP residues 1-513) + Envelope glycoprotein (UNP residues 1-28)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 SO4 SULFATE ION × 30 6YA 3-[[5-chloranyl-1-(3-methylsulfonylpropyl)indol-2-yl]methyl]-1-[2,2,2-tris(fluoranyl)ethyl]imidazo[4,5-c]pyridin-2-one × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 2.50 Å R-free 0.239
5U68 Structural basis for antibody cross-neutralization of respiratory syncytial virus and human metapneumovirus Deposited 2016-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–28（28 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28 Chain B 1–28（28 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28 Chain C 1–28（28 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；0.1M Potassium Nitrate, 0.1M Citrate Phosphate pH 4.2, 1 % Tacsimate pH 7.0, 14 (w/v) % PEG 6000	Resolution 3.08 Å R-free 0.239
6A0Z Crystal structure of broadly neutralizing antibody 13D4 bound to H5N1 influenza hemagglutinin, HA head region Deposited 2018-06-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289.15 K；0.1 M Bis-Tris-propane pH 6.5, 0.2 M NaAc and 18% (w/v) PEG 3350	Resolution 2.33 Å R-free 0.218
6APD Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425 Deposited 2017-08-17	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 1–29（29 aa） Chain B 1–29（29 aa） Chain C 1–29（29 aa）	Mutation：N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V Mutation：N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V Mutation：N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256
6CNV INFLUENZA B/BRISBANE HEMAGGLUTININ FAB CR9115 SD84H COMPLEX Deposited 2018-03-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain B 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；295 K；100 mM sodium acetate, pH 4.5, 5.5 M sodium formate, and 5% MPD	Resolution 4.10 Å R-free 0.276
6CXC 3.9A Cryo-EM structure of murine antibody bound at a novel epitope of respiratory syncytial virus fusion protein Deposited 2018-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–30（30 aa） Chain B 1–30（30 aa） Chain C 1–30（30 aa） Chain D 1–30（30 aa） Chain E 1–30（30 aa） Chain F 1–30（30 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
6DC3 RSV prefusion F bound to RSD5 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	SO4 SULFATE ION × 13 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.8 M Lithium sulfate, 0.1 M Tris pH 8.0	Resolution 3.50 Å R-free 0.205
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6G9I Crystal structure of Ebolavirus glycoprotein in complex with clomipramine Deposited 2018-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 2–28（27 aa）	Mutation：H613A,H613A,H613A,H613A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 GOL GLYCEROL × 12 CXX 3-(3-CHLORO-5H-DIBENZO[B,F]AZEPIN-5-YL)-N,N-DIMETHYLPROPAN-1-AMINE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；293 K；9% (w/v) PEG 6000 and 0.1 M Sodium citrate tribasic dihydrate	Resolution 2.19 Å R-free 0.208
6ONA Crystal structure of Influenza hemagglutinin from strain A/Hickox/JY2/1940 Deposited 2019-04-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa） Fragment：UNP residues 18-509 Chain B 1–28（28 aa） Fragment：UNP residues 18-509 Chain C 1–28（28 aa） Fragment：UNP residues 18-509	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 11 PEG DI(HYDROXYETHYL)ETHER × 7 CL CHLORIDE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；287 K；0.1 uL 9.5 mg/mL SEC-purified InvbQ.18715.a.KN11.PD38349 in 2 5 mM Tris, pH 8.5, 150 mM sodium chloride + 0.1 uL mother liquor (0.1 M sodium citrate, pH 5.5, 0.1 M magnesium chloride, 34% PEG400), flash-frozen, crystal ID 308018c7 data set les6-6	Resolution 1.95 Å R-free 0.230
6OUS Structure of fusion glycoprotein from human respiratory syncytial virus Deposited 2019-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–28（28 aa） Chain D 1–28（28 aa） Chain F 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM Tris 8.5, 10% PEG 8000, 200 mM ammonium sulfate	Resolution 3.40 Å R-free 0.275
6OUS Structure of fusion glycoprotein from human respiratory syncytial virus Deposited 2019-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain H 1–28（28 aa） Chain J 1–28（28 aa） Chain L 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM Tris 8.5, 10% PEG 8000, 200 mM ammonium sulfate	Resolution 3.40 Å R-free 0.275
6VKC Crystal Structure of Inhibitor JNJ-36811054 in Complex with Prefusion RSV F Glycoprotein Deposited 2020-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	CL CHLORIDE ION × 3 SO4 SULFATE ION × 18 R0J 3-{[5-chloro-1-(4,4,4-trifluorobutyl)-1H-imidazo[4,5-b]pyridin-2-yl]methyl}-1-cyclopropyl-1,3-dihydro-2H-imidazo[4,5-c]pyridin-2-one × 3 TAR D(-)-TARTARIC ACID × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；1.52M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.60 Å R-free 0.229
6VKD Crystal Structure of Inhibitor JNJ-36689282 in Complex with Prefusion RSV F Glycoprotein Deposited 2020-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	R0P 1-cyclopropyl-3-({1-[3-(methylsulfonyl)propyl]-1H-pyrrolo[3,2-c]pyridin-2-yl}methyl)-1,3-dihydro-2H-imidazo[4,5-c]pyridin-2-one × 3 CL CHLORIDE ION × 3 SO4 SULFATE ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；1.64M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.50 Å R-free 0.229
6VKE Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein Deposited 2020-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 R0S 4-(5-chloro-2-{[1-(3,4-dimethoxyphenyl)-2-oxo-1,2-dihydro-3H-imidazo[4,5-c]pyridin-3-yl]methyl}-1H-indol-1-yl)butanenitrile × 3 CL CHLORIDE ION × 6 SO4 SULFATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；1.64M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.10 Å R-free 0.199
6W16 Crystal structure of a human metapneumovirus monomeric fusion protein complexed with 458 Fab Deposited 2020-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.5 M Ammonium sulfate, 0.1 M Sodium citrate tribasic dihydrate pH 5.6, 1.0 M Lithium sulfate monohydrate	Resolution 3.10 Å R-free 0.234
7AD1 Cryo-EM structure of a prefusion stabilized SARS-CoV-2 Spike (D614N, R682S, R685G, A892P, A942P and V987P)(One up trimer) Deposited 2020-09-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa） Chain B 1–28（28 aa） Chain C 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.92 Å
7FJN Cryo-EM structure of South African (B.1.351) SARS-CoV-2 spike glycoprotein in complex with two T6 Fab Deposited 2021-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–28（28 aa） Chain B 1–28（28 aa） Chain C 1–28（28 aa）	Mutation：R682G,R683S,R685S,K968P,V969P,S305T Mutation：R682G,R683S,R685S,K968P,V969P,S305T Mutation：R682G,R683S,R685S,K968P,V969P,S305T	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 25	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.25 Å
7KC1 Cryo-EM structure of SRR2899884.46167H+MEDI8852L fab in complex with Victoria HA Deposited 2020-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–28（28 aa） Chain D 1–28（28 aa） Chain I 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7L7F Cryo-EM structure of human ACE2 receptor bound to protein encoded by vaccine candidate BNT162b1 Deposited 2020-12-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–28（28 aa） Chain F 1–28（28 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.24 Å
7QTI SARS-CoV-2 S Omicron Spike B.1.1.529 - 3-P2G3 and 1-P5C3 Fabs (Global) Deposited 2022-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 1–30（30 aa） Chain D 1–30（30 aa） Chain K 1–30（30 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 26	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
7ZRV cryo-EM structure of omicron spike in complex with de novo designed binder, full map Deposited 2022-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–30（30 aa） Chain B 1–30（30 aa） Chain C 1–30（30 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8HFX Cryo-EM structure of SARS-CoV-2 Omicron BA.1 spike protein in complex with white-tailed deer ACE2 Deposited 2022-11-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–29（29 aa） Chain B 1–29（29 aa） Chain C 1–29（29 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
9BJM Crystal Structure of Inhibitor 5c in Complex with Prefusion RSV F Glycoprotein Deposited 2024-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa）	Not recorded	A1APZ 1'-{[5-chloro-1-(4,4,4-trifluorobutyl)-1H-1,3-benzimidazol-2-yl]methyl}-1-(methanesulfonyl)spiro[azetidine-3,3'-indol]-2'(1'H)-one × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；3M NaFormate	Resolution 2.07 Å R-free 0.203

24 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	M1E1E4_9HIV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 464–492； UniProt 1–29 Author chain B； PDBConstruct 464–492； UniProt 1–29 Author chain C； PDBConstruct 464–492； UniProt 1–29

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7mpg
Deposition date deposition_date	2021-05-04
Structure title title	Cryo-EM structure of Prefusion-stabilized RSV F (DS-Cav1) in complex with Fab AM14
Keywords keywords	antigen, antibody, epitope, vaccine, structural vaccinology, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	54.90 Å
Radius of gyration Rg (electron density) rg_electron	55.21 Å
Forward intensity I(0) i0	1225660000.00
Molecular weight molecular_weight	290090.0 kDa
Excluded volume excluded_volume	363030 Å³
Envelope volume envelope_volume	525420 Å³
Hydration-shell volume shell_volume	86300 Å³
Envelope diameter envelope_diameter	194.7 Å
Shell Rg shell_rg	51.00 Å
Envelope Rg envelope_rg	56.03 Å
Shape Rg shape_rg	55.26 Å
Total Rg total_rg	54.88 Å
Total atoms total_atoms	20366
Residues n_residues	2607
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	193.0 Å
Rg (real space) rg_real	55.16 Å
Rg uncertainty (real space) rg_real_error	2.53 Å
I(0) (real space) i0_real	1.2260e+09
I(0) uncertainty (real space) i0_real_error	2.7840e+07
Rg (reciprocal space) rg_reciprocal	54.67 Å
I(0) (reciprocal space) i0_reciprocal	1225000000.0000
Solution quality estimate total_estimate	0.6177
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	53.2 Å
Skewness Skewness skewness	0.440
Kurtosis Kurtosis kurtosis	-0.376
Angular range angular_range	— – 0.1450 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	118400000.0000
Real-space data points n_real_points	30
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.802; Stabil: 1.000; Sysdev: 0.001; Positv: 1.000; Valcen: 0.962; Smooth: 0.654

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F0,Envelope glycoprotein
Molecular weight formula_weight	54806.5 kDa
Mutation mutation	S155C,S190F,V207L,S290C
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	20366

QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRAFLGFLLGVGSAIASGVAVCKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTFKVLDLKNYIDKQLLPILNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMCIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGGLVPR

来源 Source

来源生物 organism	Human immunodeficiency virus 1
NCBI Class编号 ncbi_taxonomy_id	11676
宿主生物 host_organism	Cricetulus griseus

Entity 2 Entity 2 polymer

Description description	AM14 Fab Heavy Chain
Molecular weight formula_weight	26380.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H,D

CVQLVESGGGVVQPGRSLRLSCAASGFSFSHYAMHWVRQAPGKGLEWVAVISYDGENTYYADSVKGRFSISRDNSKNTVSLQMNSLRPEDTALYYCARDRIVDDYYYYGMDVWGQGATVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKGSENLYFQGSHHHHHH

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	AM14 Fab Light Chain
Molecular weight formula_weight	25870.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,I,E

METPAELLFLLLLWLPDTTGDIQMTQSPSSLSASVGDRVTITCQASQDIKKYLNWYHQKPGKVPELLMHDASNLETGVPSRFSGRGSGTDFTLTISSLQPEDIGTYYCQQYDNLPPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	3

▼

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	7mpgD01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7mpgD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7mpgF01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7mpgF02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7mpgH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7mpgH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.40 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	23737

fit	/app/data/saxs_computation/mp/7mpg/7mpg.fit
pddf	/app/data/pr_computation/mp/7mpg/7mpg.pr.out
profile	/app/data/saxs_computation/mp/7mpg/7mpg.dat

Cryo-EM structure of Prefusion-stabilized RSV F (DS-Cav1) in complex with Fab AM14

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0,Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Fusion glycoprotein F0,Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

7. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)