6apd

Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0,Envelope glycoprotein

Human immunodeficiency virus 1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 15	AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C3UPB8_9MONO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–513； UniProt 1–513 Author chain B； PDBConstruct 1–513； UniProt 1–513 Author chain C； PDBConstruct 1–513； UniProt 1–513

Fusion glycoprotein F0,Envelope glycoprotein

Human immunodeficiency virus 1

UniProt M1E1E4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 15	AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	M1E1E4_9HIV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 518–546； UniProt 1–29 Author chain B； PDBConstruct 518–546； UniProt 1–29 Author chain C； PDBConstruct 518–546； UniProt 1–29

AM22 Fab Heavy Chain,IGH@ protein

Homo sapiens

UniProt Q6GMX6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 15	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6GMX6_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 112–228； UniProt 123–239 Author chain F； PDBConstruct 112–228； UniProt 123–239 Author chain H； PDBConstruct 112–228； UniProt 123–239

AM22 Fab Light Chain,Uncharacterized protein

Homo sapiens

UniProt Q8TCD0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 15	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8TCD0_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 108–215； UniProt 132–239 Author chain G； PDBConstruct 108–215； UniProt 132–239 Author chain I； PDBConstruct 108–215； UniProt 132–239

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

Homo sapiens

UniProt A0A0B4J1V1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 15	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） IGL@ protein × 3 （Q6GMX4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HV321_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 1–98； UniProt 20–117 Author chain K； PDBConstruct 1–98； UniProt 20–117 Author chain N； PDBConstruct 1–98； UniProt 20–117

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

Homo sapiens

UniProt P0DOX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 15	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） IGL@ protein × 3 （Q6GMX4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IGG1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 112–226； UniProt 109–223 Author chain K； PDBConstruct 112–226； UniProt 109–223 Author chain N； PDBConstruct 112–226； UniProt 109–223

IGL@ protein

Homo sapiens

UniProt Q6GMX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 15	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6GMX4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–218； UniProt 20–236 Author chain M； PDBConstruct 1–218； UniProt 20–236 Author chain O； PDBConstruct 1–218； UniProt 20–236

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6apd
Deposition date deposition_date	2017-08-17
Structure title title	Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425
Keywords keywords	viral glycoprotein, immunoglobulin, infant, complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

6apd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

6apd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

6apd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.05 Å
Rg (electron density)	60.80 Å
Total Rg	60.74 Å
Atom count	30005
Residues	3968
Excluded volume	534620 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`6apd__assembly_1__model_1`	pentadecameric （15）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F0,Envelope glycoprotein
Molecular weight formula_weight	63775.9 kDa
Mutation mutation	N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	30005

MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKEIKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGSMEVLFQGPGHHHHHHHHSAWSHPQFEK

Source Source

Source organism organism	Human immunodeficiency virus 1
NCBI taxonomy ID ncbi_taxonomy_id	11676
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	AM22 Fab Heavy Chain,IGH@ protein
Molecular weight formula_weight	24123.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,F,H

QVQLVQSGAEVKKPGATVKVSCKISGHTLIKLSIHWVRQAPGKGLEWMGGYEGEVDEIFYAQKFQHRLTVIADTATDTVYMELGRLTSDDTAVYFCGTLGVTVTEAGLGIDDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	AM22 Fab Light Chain,Uncharacterized protein
Molecular weight formula_weight	23305.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G,I

EIVLTQSPGTLSLSPGERATLSCRASQIVSRNHLAWYQQKPGQAPRLLIFGASSRATGIPVRFSGSGSGTDFTLTINGLAPEDFAVYYCLSSDSSIFTFGQGTKVDFKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain
Molecular weight formula_weight	23881.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,N

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGYCSGGSCHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	IGL@ protein
Molecular weight formula_weight	22955.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,O

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGFYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	229.470 Å
Unit-cell length b length_b	229.470 Å
Unit-cell length c length_c	304.050 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	4.100 Å
Low-resolution limit resolution_low	50.958 Å
R factor r_factor	0.2063
R_work r_work	0.2037
R_free r_free	0.2562

Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0,Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Fusion glycoprotein F0,Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AM22 Fab Heavy Chain,IGH@ protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AM22 Fab Light Chain,Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

IGL@ protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

6apd__assembly_1__model_1

6apd__assembly_1__model_1 | I(q)

6apd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer