6apd

Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425

Method: X-RAY DIFFRACTION D_max: 192.2 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0,Envelope glycoprotein

Human immunodeficiency virus 1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 15 PDB declaration: pentadecameric（15） Consistent with protein copy count	Chain A； UniProt 1–513 Chain B； UniProt 1–513 Chain C； UniProt 1–513	Mutation：N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V	AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 6APD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7KQD Prefusion RSV F Bound to RV521 Deposited 2020-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–513（513 aa）	Not recorded	WVA 1'-{[5-(aminomethyl)-1-(4,4,4-trifluorobutyl)-1H-benzimidazol-2-yl]methyl}-6'-fluorospiro[cyclopropane-1,3'-indol]-2'(1'H)-one × 3 SO4 SULFATE ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；293 K；0.1 M CHES pH 9.0, 0.2 M lithium sulfate and 1.77 M potassium/sodium tartrate	Resolution 2.94 Å R-free 0.249
7LUC Cryo-EM structure of RSV preF bound by Fabs 32.4K and 01.4B Deposited 2021-02-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain A 26–513（488 aa） Chain B 26–513（488 aa） Chain C 26–513（488 aa）	Mutation：N67I, S215P Mutation：N67I, S215P Mutation：N67I, S215P	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8WSQ A protective human antibody against respiratory syncytial virus by targeting a prefusion epitope across sites IV and V of the viral fusion glycoprotein. Deposited 2023-10-17	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 1–513（513 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions COUNTER-DIFFUSION；291 K；0.15 M DL-Malic acid pH 6.2, 0.1 M Imidazole pH 7.0, 27% (v/v) polyethylene glycol monomethyl ether 550	Resolution 2.90 Å R-free 0.280
8ZQ6 preF6P of RSV glycoprotein Deposited 2024-06-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 26–99（74 aa） Chain A 140–513（374 aa） Chain B 26–99（74 aa） Chain B 140–513（374 aa） Chain F 26–99（74 aa） Chain F 140–513（374 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1M Sodium citrate tribasic dihydrate pH5.5, 24% Jaffamine ED-2001 pH7.0	Resolution 2.77 Å R-free 0.237
8ZQ6 preF6P of RSV glycoprotein Deposited 2024-06-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain C 26–99（74 aa） Chain C 140–513（374 aa） Chain D 26–99（74 aa） Chain D 140–513（374 aa） Chain E 26–99（74 aa） Chain E 140–513（374 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.1M Sodium citrate tribasic dihydrate pH5.5, 24% Jaffamine ED-2001 pH7.0	Resolution 2.77 Å R-free 0.237
8ZYM Complex structure of 60 Fab bound to DS2 prefusion F trimer Deposited 2024-06-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–103（103 aa） Chain A 143–513（371 aa） Chain B 1–103（103 aa） Chain B 143–513（371 aa） Chain C 1–103（103 aa） Chain C 143–513（371 aa）	Mutation：S46G,E92D,V144S,A149C,S155C,S190F,V207L,S215P,S290C,L373R,Y458C,K465Q Mutation：S46G,E92D,V144S,A149C,S155C,S190F,V207L,S215P,S290C,L373R,Y458C,K465Q Mutation：S46G,E92D,V144S,A149C,S155C,S190F,V207L,S215P,S290C,L373R,Y458C,K465Q Mutation：S46G,E92D,V144S,A149C,S155C,S190F,V207L,S215P,S290C,L373R,Y458C,K465Q Mutation：S46G,E92D,V144S,A149C,S155C,S190F,V207L,S215P,S290C,L373R,Y458C,K465Q Mutation：S46G,E92D,V144S,A149C,S155C,S190F,V207L,S215P,S290C,L373R,Y458C,K465Q	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.23 Å

5 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	C3UPB8_9MONO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–513； UniProt 1–513 Author chain B； PDBConstruct 1–513； UniProt 1–513 Author chain C； PDBConstruct 1–513； UniProt 1–513

Fusion glycoprotein F0,Envelope glycoprotein

Human immunodeficiency virus 1

UniProt M1E1E4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 15 PDB declaration: pentadecameric（15） Consistent with protein copy count	Chain A； UniProt 1–29 Chain B； UniProt 1–29 Chain C； UniProt 1–29	Mutation：N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V	AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6APD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2M7W Independently verified structure of gp41-M-MAT, a membrane associated MPER trimer from HIV-1 gp41 Deposited 2013-05-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–59（59 aa） Chain B 1–59（59 aa） Chain C 1–59（59 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；303 K；Pressure ambient NMR sample composition 2 mM protein, 50 mM sodium phosphate, 100 mM [U-99% 2H] DPC, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
5KWW Crystal Structure of Inhibitor JNJ-53718678 In Complex with Prefusion RSV F Glycoprotein Deposited 2016-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa） Fragment：F0 (UNP residues 1-513) + Envelope glycoprotein (UNP residues 1-28)	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 SO4 SULFATE ION × 30 6YA 3-[[5-chloranyl-1-(3-methylsulfonylpropyl)indol-2-yl]methyl]-1-[2,2,2-tris(fluoranyl)ethyl]imidazo[4,5-c]pyridin-2-one × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9.5；293 K；1.54 M potassium/sodium tartrate, 0.2 M lithium sulfate, 0.1 M CHES, pH 9.5	Resolution 2.50 Å R-free 0.239
5U68 Structural basis for antibody cross-neutralization of respiratory syncytial virus and human metapneumovirus Deposited 2016-12-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–28（28 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28 Chain B 1–28（28 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28 Chain C 1–28（28 aa） Fragment：UNP P03420 residues 1-513,UNP M1E1E4 residues 1-28	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；295 K；0.1M Potassium Nitrate, 0.1M Citrate Phosphate pH 4.2, 1 % Tacsimate pH 7.0, 14 (w/v) % PEG 6000	Resolution 3.08 Å R-free 0.239
6A0Z Crystal structure of broadly neutralizing antibody 13D4 bound to H5N1 influenza hemagglutinin, HA head region Deposited 2018-06-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289.15 K；0.1 M Bis-Tris-propane pH 6.5, 0.2 M NaAc and 18% (w/v) PEG 3350	Resolution 2.33 Å R-free 0.218
6CNV INFLUENZA B/BRISBANE HEMAGGLUTININ FAB CR9115 SD84H COMPLEX Deposited 2018-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain B 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；295 K；100 mM sodium acetate, pH 4.5, 5.5 M sodium formate, and 5% MPD	Resolution 4.10 Å R-free 0.276
6CXC 3.9A Cryo-EM structure of murine antibody bound at a novel epitope of respiratory syncytial virus fusion protein Deposited 2018-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 1–30（30 aa） Chain B 1–30（30 aa） Chain C 1–30（30 aa） Chain D 1–30（30 aa） Chain E 1–30（30 aa） Chain F 1–30（30 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
6DC3 RSV prefusion F bound to RSD5 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	SO4 SULFATE ION × 13 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；1.8 M Lithium sulfate, 0.1 M Tris pH 8.0	Resolution 3.50 Å R-free 0.205
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6G9I Crystal structure of Ebolavirus glycoprotein in complex with clomipramine Deposited 2018-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 2–28（27 aa）	Mutation：H613A,H613A,H613A,H613A	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 GOL GLYCEROL × 12 CXX 3-(3-CHLORO-5H-DIBENZO[B,F]AZEPIN-5-YL)-N,N-DIMETHYLPROPAN-1-AMINE × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.2；293 K；9% (w/v) PEG 6000 and 0.1 M Sodium citrate tribasic dihydrate	Resolution 2.19 Å R-free 0.208
6ONA Crystal structure of Influenza hemagglutinin from strain A/Hickox/JY2/1940 Deposited 2019-04-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa） Fragment：UNP residues 18-509 Chain B 1–28（28 aa） Fragment：UNP residues 18-509 Chain C 1–28（28 aa） Fragment：UNP residues 18-509	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 11 PEG DI(HYDROXYETHYL)ETHER × 7 CL CHLORIDE ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；287 K；0.1 uL 9.5 mg/mL SEC-purified InvbQ.18715.a.KN11.PD38349 in 2 5 mM Tris, pH 8.5, 150 mM sodium chloride + 0.1 uL mother liquor (0.1 M sodium citrate, pH 5.5, 0.1 M magnesium chloride, 34% PEG400), flash-frozen, crystal ID 308018c7 data set les6-6	Resolution 1.95 Å R-free 0.230
6OUS Structure of fusion glycoprotein from human respiratory syncytial virus Deposited 2019-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–28（28 aa） Chain D 1–28（28 aa） Chain F 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM Tris 8.5, 10% PEG 8000, 200 mM ammonium sulfate	Resolution 3.40 Å R-free 0.275
6OUS Structure of fusion glycoprotein from human respiratory syncytial virus Deposited 2019-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain H 1–28（28 aa） Chain J 1–28（28 aa） Chain L 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM Tris 8.5, 10% PEG 8000, 200 mM ammonium sulfate	Resolution 3.40 Å R-free 0.275
6VKC Crystal Structure of Inhibitor JNJ-36811054 in Complex with Prefusion RSV F Glycoprotein Deposited 2020-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	CL CHLORIDE ION × 3 SO4 SULFATE ION × 18 R0J 3-{[5-chloro-1-(4,4,4-trifluorobutyl)-1H-imidazo[4,5-b]pyridin-2-yl]methyl}-1-cyclopropyl-1,3-dihydro-2H-imidazo[4,5-c]pyridin-2-one × 3 TAR D(-)-TARTARIC ACID × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；1.52M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.60 Å R-free 0.229
6VKD Crystal Structure of Inhibitor JNJ-36689282 in Complex with Prefusion RSV F Glycoprotein Deposited 2020-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	R0P 1-cyclopropyl-3-({1-[3-(methylsulfonyl)propyl]-1H-pyrrolo[3,2-c]pyridin-2-yl}methyl)-1,3-dihydro-2H-imidazo[4,5-c]pyridin-2-one × 3 CL CHLORIDE ION × 3 SO4 SULFATE ION × 18	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；1.64M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.50 Å R-free 0.229
6VKE Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein Deposited 2020-01-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	NHE 2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID × 3 R0S 4-(5-chloro-2-{[1-(3,4-dimethoxyphenyl)-2-oxo-1,2-dihydro-3H-imidazo[4,5-c]pyridin-3-yl]methyl}-1H-indol-1-yl)butanenitrile × 3 CL CHLORIDE ION × 6 SO4 SULFATE ION × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；1.64M K/Na tartrate, 0.2M LiSO4, 0.1M CHES pH 9.5	Resolution 2.10 Å R-free 0.199
6W16 Crystal structure of a human metapneumovirus monomeric fusion protein complexed with 458 Fab Deposited 2020-03-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.5 M Ammonium sulfate, 0.1 M Sodium citrate tribasic dihydrate pH 5.6, 1.0 M Lithium sulfate monohydrate	Resolution 3.10 Å R-free 0.234
7AD1 Cryo-EM structure of a prefusion stabilized SARS-CoV-2 Spike (D614N, R682S, R685G, A892P, A942P and V987P)(One up trimer) Deposited 2020-09-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa） Chain B 1–28（28 aa） Chain C 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 10	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.92 Å
7FJN Cryo-EM structure of South African (B.1.351) SARS-CoV-2 spike glycoprotein in complex with two T6 Fab Deposited 2021-08-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–28（28 aa） Chain B 1–28（28 aa） Chain C 1–28（28 aa）	Mutation：R682G,R683S,R685S,K968P,V969P,S305T Mutation：R682G,R683S,R685S,K968P,V969P,S305T Mutation：R682G,R683S,R685S,K968P,V969P,S305T	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 25	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.25 Å
7KC1 Cryo-EM structure of SRR2899884.46167H+MEDI8852L fab in complex with Victoria HA Deposited 2020-10-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–28（28 aa） Chain D 1–28（28 aa） Chain I 1–28（28 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
7L7F Cryo-EM structure of human ACE2 receptor bound to protein encoded by vaccine candidate BNT162b1 Deposited 2020-12-28	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 1–28（28 aa） Chain F 1–28（28 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.24 Å
7MPG Cryo-EM structure of Prefusion-stabilized RSV F (DS-Cav1) in complex with Fab AM14 Deposited 2021-05-04	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 1–29（29 aa） Chain B 1–29（29 aa） Chain C 1–29（29 aa）	Mutation：S155C,S190F,V207L,S290C Mutation：S155C,S190F,V207L,S290C Mutation：S155C,S190F,V207L,S290C	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7QTI SARS-CoV-2 S Omicron Spike B.1.1.529 - 3-P2G3 and 1-P5C3 Fabs (Global) Deposited 2022-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 11 PDB declaration: undecameric	Chain A 1–30（30 aa） Chain D 1–30（30 aa） Chain K 1–30（30 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 26	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；PBS cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
7ZRV cryo-EM structure of omicron spike in complex with de novo designed binder, full map Deposited 2022-05-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–30（30 aa） Chain B 1–30（30 aa） Chain C 1–30（30 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 16	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
8HFX Cryo-EM structure of SARS-CoV-2 Omicron BA.1 spike protein in complex with white-tailed deer ACE2 Deposited 2022-11-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–29（29 aa） Chain B 1–29（29 aa） Chain C 1–29（29 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31 ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.98 Å
9BJM Crystal Structure of Inhibitor 5c in Complex with Prefusion RSV F Glycoprotein Deposited 2024-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–28（28 aa）	Not recorded	A1APZ 1'-{[5-chloro-1-(4,4,4-trifluorobutyl)-1H-1,3-benzimidazol-2-yl]methyl}-1-(methanesulfonyl)spiro[azetidine-3,3'-indol]-2'(1'H)-one × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；3M NaFormate	Resolution 2.07 Å R-free 0.203

24 other PDB entries and 27 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	M1E1E4_9HIV1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 518–546； UniProt 1–29 Author chain B； PDBConstruct 518–546； UniProt 1–29 Author chain C； PDBConstruct 518–546； UniProt 1–29

AM22 Fab Heavy Chain,IGH@ protein

Homo sapiens

UniProt Q6GMX6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 15 PDB declaration: pentadecameric（15） Consistent with protein copy count	Chain D； UniProt 123–239 Chain F； UniProt 123–239 Chain H； UniProt 123–239	Not recorded	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6APD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1ZA6 The structure of an antitumor CH2-domain-deleted humanized antibody Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 225–465（241 aa） Chain D 225–465（241 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；290 K；4 M sodium formate, 1.5 mM Triton X-100 detergent, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 290K, pH 7.20	Resolution 2.80 Å R-free 0.296
1ZA6 The structure of an antitumor CH2-domain-deleted humanized antibody Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain F 225–465（241 aa） Chain H 225–465（241 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；290 K；4 M sodium formate, 1.5 mM Triton X-100 detergent, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 290K, pH 7.20	Resolution 2.80 Å R-free 0.296
1ZA6 The structure of an antitumor CH2-domain-deleted humanized antibody Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain B 225–465（241 aa） Chain D 225–465（241 aa） Chain F 225–465（241 aa） Chain H 225–465（241 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；290 K；4 M sodium formate, 1.5 mM Triton X-100 detergent, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 290K, pH 7.20	Resolution 2.80 Å R-free 0.296
1ZA6 The structure of an antitumor CH2-domain-deleted humanized antibody Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 225–465（241 aa） Chain D 225–465（241 aa） Chain F 225–465（241 aa） Chain H 225–465（241 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.2；290 K；4 M sodium formate, 1.5 mM Triton X-100 detergent, pH 7.2, VAPOR DIFFUSION, SITTING DROP, temperature 290K, pH 7.20	Resolution 2.80 Å R-free 0.296
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 131–237（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 131–237（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 131–237（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 131–237（107 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
5O1R human Fab 5H2 bound to NHBA-C3 from Neisseria meningitidis serogroup B Deposited 2017-05-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 20–240（221 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M TRIS pH 8.0 and 1.6 M lithium sulphate	Resolution 2.86 Å R-free 0.222
5O1R human Fab 5H2 bound to NHBA-C3 from Neisseria meningitidis serogroup B Deposited 2017-05-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 20–240（221 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M TRIS pH 8.0 and 1.6 M lithium sulphate	Resolution 2.86 Å R-free 0.222
5UTZ Human IL-2/Fab complex Deposited 2017-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 128–238（111 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；295 K；100 mM sodium citrate, pH 5.0, 20% PEG6000	Resolution 2.75 Å R-free 0.247
5UTZ Human IL-2/Fab complex Deposited 2017-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 128–238（111 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；295 K；100 mM sodium citrate, pH 5.0, 20% PEG6000	Resolution 2.75 Å R-free 0.247
5UTZ Human IL-2/Fab complex Deposited 2017-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 128–238（111 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；295 K；100 mM sodium citrate, pH 5.0, 20% PEG6000	Resolution 2.75 Å R-free 0.247
5UTZ Human IL-2/Fab complex Deposited 2017-02-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 128–238（111 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；295 K；100 mM sodium citrate, pH 5.0, 20% PEG6000	Resolution 2.75 Å R-free 0.247
5VR9 CH1/Ckappa Fab based on Matuzumab Deposited 2017-05-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 122–238（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；294 K；see publication for details	Resolution 2.15 Å R-free 0.244
5VR9 CH1/Ckappa Fab based on Matuzumab Deposited 2017-05-10	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 122–238（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；294 K；see publication for details	Resolution 2.15 Å R-free 0.244
5VSI CH1/Ckappa Fab mutant 15.1 Deposited 2017-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 122–235（114 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 5 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；294 K；see publication	Resolution 1.51 Å R-free 0.227
6AL4 CRYSTAL STRUCTURE OF ANTI-CD19 ANTIBODY B43 FAB Deposited 2017-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 125–238（114 aa） Fragment：FD,FD,FD,FD	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；293 K；20% PEG 3350, 0.2 M NA PHOSPHATE DIBASIC	Resolution 2.45 Å R-free 0.236
6AL4 CRYSTAL STRUCTURE OF ANTI-CD19 ANTIBODY B43 FAB Deposited 2017-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 125–238（114 aa） Fragment：FD,FD,FD,FD	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；293 K；20% PEG 3350, 0.2 M NA PHOSPHATE DIBASIC	Resolution 2.45 Å R-free 0.236
6AL4 CRYSTAL STRUCTURE OF ANTI-CD19 ANTIBODY B43 FAB Deposited 2017-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 125–238（114 aa） Fragment：FD,FD,FD,FD	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 9.1；293 K；20% PEG 3350, 0.2 M NA PHOSPHATE DIBASIC	Resolution 2.45 Å R-free 0.236
6B9Y Trastuzumab Fab v3 in complex with 5-phenyl meditope variant Deposited 2017-10-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 124–238（115 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Tris pH 7.5, 15% PEG3350, 24 mM NaCl	Resolution 2.14 Å R-free 0.218
6BAH Trastuzumab Fab v3 with 5-diphenyl meditope variant Deposited 2017-10-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 124–238（115 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.1 M Tris, pH 7.5, 24 mM NaCl, 15% PEG 3350	Resolution 1.90 Å R-free 0.194
6DC4 RSV-neutralizing human antibody AM22 Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 123–239（117 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 17	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.02 M 1,6-Hexanediol, 0.02 M 1-Butanol, 0.02 M 1,2-Propanediol (racemic), 0.02 M 2-Propanol, 0.02 M 1,4-Butanediol, 0.02 M 1,3-Propanediol, 0.1 M MES/imidazole pH 6.5, 10% PEG 8000, 20% ethylene glycol	Resolution 1.70 Å R-free 0.205
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 123–239（117 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 123–239（117 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 123–239（117 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6OGE Cryo-EM structure of Her2 extracellular domain-Trastuzumab Fab-Pertuzumab Fab complex Deposited 2019-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 124–235（112 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.36 Å
6VPY I33M (I3.2 mutant from CH103 Lineage) Deposited 2020-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 125–240（116 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；1.5 M ammonium sulfate, 100 mM HEPES, pH 7.23, 5% PEG400	Resolution 2.36 Å R-free 0.223
6VPY I33M (I3.2 mutant from CH103 Lineage) Deposited 2020-02-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 125–240（116 aa）	Not recorded	GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；1.5 M ammonium sulfate, 100 mM HEPES, pH 7.23, 5% PEG400	Resolution 2.36 Å R-free 0.223
7CZR S protein of SARS-CoV-2 in complex bound with P5A-1B8_2B Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 123–465（343 aa） Chain J 123–465（343 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7CZS S protein of SARS-CoV-2 in complex bound with P5A-1B8_3B Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 123–465（343 aa） Chain I 123–465（343 aa） Chain J 123–465（343 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7CZX S protein of SARS-CoV-2 in complex bound with P5A-1B9 Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 121–465（345 aa） Chain I 121–465（345 aa） Chain J 121–465（345 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7D00 S protein of SARS-CoV-2 in complex bound with FabP5A-1B8 Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 123–465（343 aa） Chain J 123–465（343 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8BBO SARS-CoV-2 Delta-RBD complexed with BA.2-36 Fab Deposited 2022-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 20–240（221 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；2% (v/v) PEG400, 0.1M imidazole pH7.0 and 24% (w/v) PEG MME 5000.	Resolution 2.75 Å R-free 0.252

18 other PDB entries and 34 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q6GMX6_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 112–228； UniProt 123–239 Author chain F； PDBConstruct 112–228； UniProt 123–239 Author chain H； PDBConstruct 112–228； UniProt 123–239

AM22 Fab Light Chain,Uncharacterized protein

Homo sapiens

UniProt Q8TCD0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 15 PDB declaration: pentadecameric（15） Consistent with protein copy count	Chain E； UniProt 132–239 Chain G； UniProt 132–239 Chain I； UniProt 132–239	Not recorded	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5） IGL@ protein × 3 （Q6GMX4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6APD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1HZH CRYSTAL STRUCTURE OF THE INTACT HUMAN IGG B12 WITH BROAD AND POTENT ACTIVITY AGAINST PRIMARY HIV-1 ISOLATES: A TEMPLATE FOR HIV VACCINE DESIGN Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain L 132–239（108 aa） Chain M 132–239（108 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295.5 K；NH4SO4, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.70 Å R-free 0.273
1N0X Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope Deposited 2002-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain L 132–239（108 aa） Fragment：UNP residues 132-239 Chain M 132–239（108 aa） Fragment：UNP residues 132-239	Not recorded	GOL GLYCEROL × 8 SO4 SULFATE ION × 4 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.5；295.5 K；ammonium sulfate, lithium sulfate, CAPS buffer, pH 10.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 1.80 Å R-free 0.252
3CFJ Crystal structure of catalytic elimination antibody 34E4, orthorhombic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 131–239（109 aa）	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；30% MPEG 2000, 0.2M (NH4)2SO4, 0.1M ACETATE, PH 4.6, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 4.60	Resolution 2.60 Å R-free 0.253
3CFJ Crystal structure of catalytic elimination antibody 34E4, orthorhombic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 131–239（109 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；30% MPEG 2000, 0.2M (NH4)2SO4, 0.1M ACETATE, PH 4.6, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 4.60	Resolution 2.60 Å R-free 0.253
3CFJ Crystal structure of catalytic elimination antibody 34E4, orthorhombic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 131–239（109 aa）	Not recorded	GOL GLYCEROL × 1 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；30% MPEG 2000, 0.2M (NH4)2SO4, 0.1M ACETATE, PH 4.6, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 4.60	Resolution 2.60 Å R-free 0.253
3CFJ Crystal structure of catalytic elimination antibody 34E4, orthorhombic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.6；30% MPEG 2000, 0.2M (NH4)2SO4, 0.1M ACETATE, PH 4.6, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 4.60	Resolution 2.60 Å R-free 0.253
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 131–239（109 aa）	Not recorded	CD CADMIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 131–239（109 aa）	Not recorded	CD CADMIUM ION × 3 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 131–239（109 aa）	Not recorded	CD CADMIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 131–239（109 aa）	Not recorded	CD CADMIUM ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 131–239（109 aa）	Not recorded	CD CADMIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 131–239（109 aa）	Not recorded	CD CADMIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 131–239（109 aa）	Not recorded	CD CADMIUM ION × 1 B3P 2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3CFK Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form Deposited 2008-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 131–239（109 aa）	Not recorded	CD CADMIUM ION × 1 B3P 2-[3-(2-HYDROXY-1,1-DIHYDROXYMETHYL-ETHYLAMINO)-PROPYLAMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.7；33% PEG 2000, 0.2M CDCL2, 0.1M BIS- TRIS-PROPANE, PH 6.7, VAPOR DIFFUSION, SITTING DROP, TEMPERATURE 298K, pH 6.70	Resolution 2.60 Å R-free 0.244
3MNV Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment Deposited 2010-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 133–239（107 aa） Fragment：FUSION PROTEIN between mouse Fv and a human Fc	Not recorded	SO4 SULFATE ION × 4 EDO 1,2-ETHANEDIOL × 3 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；298 K；Qiagen AmSO4 suite, reservoir: 2.2 M ammonium sulfate, 0.2 M lithium nitrate. Drop: 0.5 uL protein + 0.5 uL reservoir., VAPOR DIFFUSION, temperature 298K	Resolution 2.40 Å R-free 0.228
3MNV Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment Deposited 2010-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 133–239（107 aa） Fragment：FUSION PROTEIN between mouse Fv and a human Fc	Not recorded	SO4 SULFATE ION × 2 EDO 1,2-ETHANEDIOL × 1 NO3 NITRATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；298 K；Qiagen AmSO4 suite, reservoir: 2.2 M ammonium sulfate, 0.2 M lithium nitrate. Drop: 0.5 uL protein + 0.5 uL reservoir., VAPOR DIFFUSION, temperature 298K	Resolution 2.40 Å R-free 0.228
3MNW Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment with a gp41 MPER-derived peptide in a helical conformation Deposited 2010-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 126–239（114 aa） Fragment：mouse Fv,human Fc	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；Reservoir: Qiagen Classics II screen H10 (0.2 M K Na tartrate, 20% PEG 3350). Drop: 0.6 uL protein + 0.4 uL reservoir., pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 2.20 Å R-free 0.253
3MNW Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment with a gp41 MPER-derived peptide in a helical conformation Deposited 2010-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 126–239（114 aa） Fragment：mouse Fv,human Fc	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；Reservoir: Qiagen Classics II screen H10 (0.2 M K Na tartrate, 20% PEG 3350). Drop: 0.6 uL protein + 0.4 uL reservoir., pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 2.20 Å R-free 0.253
3MNZ Crystal structure of the non-neutralizing HIV antibody 13H11 Fab fragment with a gp41 MPER-derived peptide bearing Ala substitutions in a helical conformation Deposited 2010-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 126–239（114 aa） Fragment：mouse Fv,human Fc	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；Reservoir: Qiagen Classics II, condition with 0.2 M K Na tartrate, 20% PEG 3350. Drop: 0.6 uL protein + 0.4 uL reservoir, pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 1.80 Å R-free 0.215
3PGF Crystal structure of maltose bound MBP with a conformationally specific synthetic antigen binder (sAB) Deposited 2010-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 132–239（108 aa）	Not recorded	IMD IMIDAZOLE × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；292 K；19% PEG 3400, 8% Tacsimate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 2.10 Å R-free 0.227
4D9Q Inhibiting Alternative Pathway Complement Activation by Targeting the Exosite on Factor D Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 130–238（109 aa）	Not recorded	GOL GLYCEROL × 3 ZN ZINC ION × 4 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.1 M MES pH 6.5, 25% PEG 550 MME, 0.01 M zinc sulfate and 3% 6-aminohexanoic acid, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.28 Å R-free 0.230
4D9Q Inhibiting Alternative Pathway Complement Activation by Targeting the Exosite on Factor D Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 130–238（109 aa）	Not recorded	GOL GLYCEROL × 7 ZN ZINC ION × 3 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.1 M MES pH 6.5, 25% PEG 550 MME, 0.01 M zinc sulfate and 3% 6-aminohexanoic acid, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.28 Å R-free 0.230
4D9Q Inhibiting Alternative Pathway Complement Activation by Targeting the Exosite on Factor D Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 130–238（109 aa） Chain L 130–238（109 aa）	Not recorded	GOL GLYCEROL × 10 ZN ZINC ION × 7 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.1 M MES pH 6.5, 25% PEG 550 MME, 0.01 M zinc sulfate and 3% 6-aminohexanoic acid, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.28 Å R-free 0.230
4NUG Crystal structure of HIV-1 broadly neutralizing antibody PGT151 Deposited 2013-12-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 132–239（108 aa）	Not recorded	P6G HEXAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.2；293.15 K；40% PEG 3350, 0.1M phosphate-citrate, pH 4.2, VAPOR DIFFUSION, temperature 293.15K	Resolution 1.86 Å R-free 0.207
4NUJ Crystal structure of HIV-1 broadly neutralizing antibody PGT152 Deposited 2013-12-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 132–239（108 aa）	Mutation：N107K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.2；293.15 K；40% PEG 600, 0.1M phosphate-citrate, pH 4.2, VAPOR DIFFUSION, temperature 293.15K	Resolution 1.83 Å R-free 0.210
4NWT Crystal structure of the anti-human NGF Fab APE1531 Deposited 2013-12-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 131–239（109 aa）	Not recorded	MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 ACT ACETATE ION × 4 PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；12% PEG 20000, 0.1M NaCl, 0.1M MES pH6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.75 Å R-free 0.181
4NWU Crystal structure of APE1551, an anti-human NGF Fab with a nine amino acid insertion in CDR H1 Deposited 2013-12-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；16% PEG 6000, 0.1 M Citric acid pH6.0-7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 1.60 Å R-free 0.198
5VIY BG505 SOSIP.664 in complex with broadly neutralizing antibodies BG1 and 8ANC195 Deposited 2017-04-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 16 PDB declaration: hexadecameric	Chain L 132–239（108 aa） Chain N 132–239（108 aa） Chain P 132–239（108 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 13	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 6.20 Å
5VJ6 BG505 SOSIP.664 in complex with broadly neutralizing antibodies PG9 and 8ANC195 Deposited 2017-04-18	Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain N 132–239（108 aa） Chain P 132–239（108 aa） Chain R 132–239（108 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 11.50 Å
5VKK Crystal structure of Fab fragment of anti-CD22 Epratuzumab Deposited 2017-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 126–239（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；85 mM Tris, pH 8.5, 25.5% PEG 4000 (w/v), 170 mM sodium acetate and 15% glycerol	Resolution 2.01 Å R-free 0.237
5VKK Crystal structure of Fab fragment of anti-CD22 Epratuzumab Deposited 2017-04-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 126–239（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；85 mM Tris, pH 8.5, 25.5% PEG 4000 (w/v), 170 mM sodium acetate and 15% glycerol	Resolution 2.01 Å R-free 0.237
5VL3 CD22 d1-d3 in complex with therapeutic Fab Epratuzumab Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 126–239（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20 mM Tris pH 8.0 and 150 mM NaCl, 5mg/mL	Resolution 3.10 Å R-free 0.295
5VL3 CD22 d1-d3 in complex with therapeutic Fab Epratuzumab Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 126–239（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20 mM Tris pH 8.0 and 150 mM NaCl, 5mg/mL	Resolution 3.10 Å R-free 0.295
5VL3 CD22 d1-d3 in complex with therapeutic Fab Epratuzumab Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 126–239（114 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20 mM Tris pH 8.0 and 150 mM NaCl, 5mg/mL	Resolution 3.10 Å R-free 0.295
5VL3 CD22 d1-d3 in complex with therapeutic Fab Epratuzumab Deposited 2017-04-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 126–239（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；20 mM Tris pH 8.0 and 150 mM NaCl, 5mg/mL	Resolution 3.10 Å R-free 0.295
5VOD Crystal structure of HCMV Pentamer in complex with neutralizing antibody 9I6 Deposited 2017-05-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 7 PDB declaration: heptameric	Chain L 123–239（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；10% (wt/vol) PEG methyl ether 500 0.1 M MES pH 6.2 0.00001 M phenol	Resolution 5.90 Å R-free 0.299
5VOD Crystal structure of HCMV Pentamer in complex with neutralizing antibody 9I6 Deposited 2017-05-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain L 123–239（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；10% (wt/vol) PEG methyl ether 500 0.1 M MES pH 6.2 0.00001 M phenol	Resolution 5.90 Å R-free 0.299
5VQM Clostridium difficile TcdB-GTD bound to PA41 Fab Deposited 2017-05-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；294 K；0.1 M Bis-Tris pH 5.5 1 M NaCl 11% PEG3350	Resolution 2.79 Å R-free 0.292
5VQM Clostridium difficile TcdB-GTD bound to PA41 Fab Deposited 2017-05-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；294 K；0.1 M Bis-Tris pH 5.5 1 M NaCl 11% PEG3350	Resolution 2.79 Å R-free 0.292
5W42 Crystal structure of human monoclonal antibody H3v-47 in complex with influenza virus hemagglutinin from A/Minnesota/11/2010 (H3N2) Deposited 2017-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain L 131–239（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；277 K；10% (v/v) 2-methyl-2,4-pentanediol (MPD), 0.1M MES (pH 5.0)	Resolution 3.57 Å R-free 0.228
5XRQ Crystal structure of human monoclonal antibody H3v-47 Deposited 2017-06-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；20% (w/v) polyethylene glycol (PEG) 6000, 0.1 M sodium citrate (pH 5.0)	Resolution 2.60 Å R-free 0.214
5XRQ Crystal structure of human monoclonal antibody H3v-47 Deposited 2017-06-09	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5；293 K；20% (w/v) polyethylene glycol (PEG) 6000, 0.1 M sodium citrate (pH 5.0)	Resolution 2.60 Å R-free 0.214
6ARP Structure of a mutant Cetuximab Fab fragment Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 132–239（108 aa）	Not recorded	SO4 SULFATE ION × 3 GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM sodium citrate, 1.6 M ammonium sulfate, 5% glycerol	Resolution 1.70 Å R-free 0.197
6ARP Structure of a mutant Cetuximab Fab fragment Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 132–239（108 aa）	Not recorded	SO4 SULFATE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM sodium citrate, 1.6 M ammonium sulfate, 5% glycerol	Resolution 1.70 Å R-free 0.197
6ARU Structure of Cetuximab Fab mutant in complex with EGFR extracellular domain Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 132–239（108 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；150 mM ammonium sulfate, 16.5% PEG3350, 10 mM cadmium chloride, 100 mM imidazole, 5% glycerol	Resolution 3.20 Å R-free 0.267
6BFT Structure of Bevacizumab Fab mutant in complex with VEGF Deposited 2017-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 130–239（110 aa） Chain L 130–239（110 aa）	Not recorded	SO4 SULFATE ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；100 mM MES, 6.0, 225 mM ammonium sulfate, 13% PEG4000, 10% isopropanol	Resolution 2.55 Å R-free 0.220
6BKC Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody AR3B Deposited 2017-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 131–239（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293 K；20% (w/v) PEG 3500, 0.2M Li-chloride	Resolution 2.60 Å R-free 0.276
6DC4 RSV-neutralizing human antibody AM22 Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 132–239（108 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 17	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；0.02 M 1,6-Hexanediol, 0.02 M 1-Butanol, 0.02 M 1,2-Propanediol (racemic), 0.02 M 2-Propanol, 0.02 M 1,4-Butanediol, 0.02 M 1,3-Propanediol, 0.1 M MES/imidazole pH 6.5, 10% PEG 8000, 20% ethylene glycol	Resolution 1.70 Å R-free 0.205
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 132–239（108 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 132–239（108 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DC5 RSV prefusion F in complex with AM22 Fab Deposited 2018-05-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 132–239（108 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CD CADMIUM ION × 1 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；32% PEG 400, 4% PEG 3350, 0.01 M cadmium chloride, 0.1 M sodium acetate pH 5.5	Resolution 3.50 Å R-free 0.280
6DCQ Ectodomain of full length, wild type HIV-1 glycoprotein clone PC64M18C043 in complex with PGT151 Fab Deposited 2018-05-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 10 PDB declaration: decameric	Chain L 132–239（108 aa） Chain N 132–239（108 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Detergent removed with Biobeads prior to grid freezing cryo-EM vitrification conditions Cryogen ETHANE；Blot force 0 Blot time 5 sec	Resolution 3.10 Å
6E4X Human antibody S5V2-29 in complex with influenza hemagglutinin A/Texas/50/2012 (H3N2) Deposited 2018-07-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain Y 122–239（118 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291.15 K；100 mM magnesium sulfate, 100 mM PIPES, pH 6.0, 30% PEG400	Resolution 2.25 Å R-free 0.225
6NZ7 Crystal structure of broadly neutralizing Influenza A antibody 429 B01 in complex with Hemagglutinin Hong Kong 1968 Deposited 2019-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain L 130–239（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；300 K；10 % PEG8000 (w/v), 100 mM Tris/Cl, pH 8.5 and 7.5 % 1,6-hexanediol (w/v)	Resolution 2.95 Å R-free 0.267
6NZ7 Crystal structure of broadly neutralizing Influenza A antibody 429 B01 in complex with Hemagglutinin Hong Kong 1968 Deposited 2019-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain I 130–239（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；300 K；10 % PEG8000 (w/v), 100 mM Tris/Cl, pH 8.5 and 7.5 % 1,6-hexanediol (w/v)	Resolution 2.95 Å R-free 0.267
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 131–239（109 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6UC5 Fab397 in complex with NPNA peptide Deposited 2019-09-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 122–238（117 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M HEPES, pH 6.62, 22% w/v PEG4000	Resolution 1.75 Å R-free 0.225
7CZQ S protein of SARS-CoV-2 in complex bound with P2B-1A10 Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain K 122–239（118 aa） Chain N 122–239（118 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7CZR S protein of SARS-CoV-2 in complex bound with P5A-1B8_2B Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain K 130–239（110 aa） Chain N 130–239（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 30	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7CZS S protein of SARS-CoV-2 in complex bound with P5A-1B8_3B Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain K 130–239（110 aa） Chain M 130–239（110 aa） Chain N 130–239（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
7CZU S protein of SARS-CoV-2 in complex bound with P5A-1B6_2B Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain K 122–239（118 aa） Chain N 122–239（118 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7CZV S protein of SARS-CoV-2 in complex bound with P5A-1B6_3B Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain K 122–239（118 aa） Chain M 122–239（118 aa） Chain N 122–239（118 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7CZX S protein of SARS-CoV-2 in complex bound with P5A-1B9 Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain K 130–239（110 aa） Chain M 130–239（110 aa） Chain N 130–239（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 33	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7D00 S protein of SARS-CoV-2 in complex bound with FabP5A-1B8 Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain K 130–239（110 aa） Chain N 130–239（110 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

39 other PDB entries and 66 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q8TCD0_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 108–215； UniProt 132–239 Author chain G； PDBConstruct 108–215； UniProt 132–239 Author chain I； PDBConstruct 108–215； UniProt 132–239

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

Homo sapiens

UniProt A0A0B4J1V1

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 15 PDB declaration: pentadecameric（15） Consistent with protein copy count	Chain J； UniProt 20–117 Chain K； UniProt 20–117 Chain N； UniProt 20–117	Not recorded	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） IGL@ protein × 3 （Q6GMX4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	HV321_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 1–98； UniProt 20–117 Author chain K； PDBConstruct 1–98； UniProt 20–117 Author chain N； PDBConstruct 1–98； UniProt 20–117

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

Homo sapiens

UniProt P0DOX5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 15 PDB declaration: pentadecameric（15） Consistent with protein copy count	Chain J； UniProt 109–223 Chain K； UniProt 109–223 Chain N； UniProt 109–223	Not recorded	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） IGL@ protein × 3 （Q6GMX4）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6APD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1D5B UNLIGANDED MATURE OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220) Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；25%PEG 1000, 100mM sodium acetate, 300mM CdCl2, 100mM ammonium sulfate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.285
1D5B UNLIGANDED MATURE OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；25%PEG 1000, 100mM sodium acetate, 300mM CdCl2, 100mM ammonium sulfate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.285
1D5B UNLIGANDED MATURE OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；25%PEG 1000, 100mM sodium acetate, 300mM CdCl2, 100mM ammonium sulfate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.285
1D5I UNLIGANDED GERMLINE PRECURSOR OF AN OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；75mM Hepes pH 7.0 9% PEG 4000 150 mM Ammonium Sulfate 20% 1,4 butanediol 100 mM Cadmium Chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.263
1D6V CONFORMATION EFFECTS IN BIOLOGICAL CATALYSIS INTRODUCED BY OXY-COPE ANTIBODY MATURATION Deposited 1999-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 4 HOP (1S,2S,5S)2-(4-GLUTARIDYLBENZYL)-5-PHENYL-1-CYCLOHEXANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；292 K；9% polyethylene glycol 4000 250mM ammonium sulfate 80mM Cadmium Chloride 75mM Hepes 20% 1,4 butanediol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 19K	Resolution 2.00 Å R-free 0.264
1HZH CRYSTAL STRUCTURE OF THE INTACT HUMAN IGG B12 WITH BROAD AND POTENT ACTIVITY AGAINST PRIMARY HIV-1 ISOLATES: A TEMPLATE FOR HIV VACCINE DESIGN Deposited 2001-01-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 117–449（333 aa） Chain K 117–449（333 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295.5 K；NH4SO4, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.70 Å R-free 0.273
1N0X Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope Deposited 2002-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain H 117–222（106 aa） Fragment：UNP residues 117-222 Chain K 117–222（106 aa） Fragment：UNP residues 117-222	Not recorded	GOL GLYCEROL × 8 SO4 SULFATE ION × 4 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.5；295.5 K；ammonium sulfate, lithium sulfate, CAPS buffer, pH 10.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 1.80 Å R-free 0.252
3PGF Crystal structure of maltose bound MBP with a conformationally specific synthetic antigen binder (sAB) Deposited 2010-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 121–227（107 aa）	Not recorded	IMD IMIDAZOLE × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；292 K；19% PEG 3400, 8% Tacsimate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 2.10 Å R-free 0.227
4R26 Crystal structure of human Fab PGT124, a broadly neutralizing and potent HIV-1 neutralizing antibody Deposited 2014-08-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 115–223（109 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M MgCl2, 0.1M Tris-HCL, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.267
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain Q 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain J 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain N 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
5O4E Crystal structure of VEGF in complex with heterodimeric Fcab JanusCT6 Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 227–449（223 aa） Chain B 227–449（223 aa） Chain C 227–448（222 aa） Chain D 227–449（223 aa）	Mutation：T350V, T366L, K392L, T394W Mutation：;T350V, L351Y, T359R, K360F, N361Y, E388D, N389I, F389a, P389b, N389c, G389d, L389e, F405A, Y407V, D413P, K414Y, S415P, R416S, Q418L, Q419M, N421T, V422R, S440H, S442E, L443Y, S444Q, P445W, G446P, K447T ; Mutation：T350V, T366L, K392L, T394W Mutation：;T350V, L351Y, T359R, K360F, N361Y, E388D, N389I, F389a, P389b, N389c, G389d, L389e, F405A, Y407V, D413P, K414Y, S415P, R416S, Q418L, Q419M, N421T, V422R, S440H, S442E, L443Y, S444Q, P445W, G446P, K447T ;	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 10 MRD (4R)-2-METHYLPENTANE-2,4-DIOL × 1 CAC CACODYLATE ION × 2 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；0.1 M Sodium cacodylate, 40% (v/v) MPD, 5% (w/v) PEG 8000	Resolution 2.15 Å R-free 0.236
5VJ6 BG505 SOSIP.664 in complex with broadly neutralizing antibodies PG9 and 8ANC195 Deposited 2017-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain H 117–224（108 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 11.50 Å
5VU0 Crystal structure of the complex between afucosylated/galactosylated human IgG1 Fc and Fc gamma receptor IIIa (CD16A) with Man5 N-glycans Deposited 2017-05-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 230–446（217 aa） Fragment：Fc region (UNP residues 230-446) Chain B 230–446（217 aa） Fragment：Fc region (UNP residues 230-446)	Not recorded	EDO 1,2-ETHANEDIOL × 5 PEG DI(HYDROXYETHYL)ETHER × 4 NA SODIUM ION × 9 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM Bis-Tris Propane pH 7.5, 16% PEG 20k, 100 mM Potassium thiocyanate, Cryo protection - 20% Ethylene Glycol	Resolution 2.26 Å R-free 0.237
5VZX Crystal structure of crenezumab Fab Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 115–227（113 aa） Chain H 115–227（113 aa）	Not recorded	SO4 SULFATE ION × 11 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.4 M ammonium sulfate, 0.1M HEPES pH 7.5	Resolution 2.50 Å R-free 0.230
5VZX Crystal structure of crenezumab Fab Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 115–227（113 aa）	Not recorded	SO4 SULFATE ION × 6 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.4 M ammonium sulfate, 0.1M HEPES pH 7.5	Resolution 2.50 Å R-free 0.230
5VZX Crystal structure of crenezumab Fab Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 115–227（113 aa）	Not recorded	SO4 SULFATE ION × 5 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.4 M ammonium sulfate, 0.1M HEPES pH 7.5	Resolution 2.50 Å R-free 0.230
5VZY Crystal structure of crenezumab Fab in complex with Abeta Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 115–227（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M magnesium chloride hexahydrate, 0.1 M Tris hydrochloride pH 8.5, 30% w/v polyethylene glycol 4000	Resolution 2.32 Å R-free 0.249
5W5L Crystal structure of human IgG1-Sigma Fc fragment Deposited 2017-06-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 227–449（223 aa） Fragment：Sigma Fc fragment, UNP residues 227-449 Chain B 227–449（223 aa） Fragment：Sigma Fc fragment, UNP residues 227-449	Mutation：L234A, L235A, A237G, P238S, H268A, A330S, P331S Mutation：L234A, L235A, A237G, P238S, H268A, A330S, P331S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；9% PEG 20,000, 0.1 M Sodium Acetate, pH 5.5	Resolution 1.90 Å R-free 0.229
5WAV Fc AbVance: Increasing our knowledge of antibody structural space to enable faster and better decision-making in antibody drug discovery. Deposited 2017-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 240–448（209 aa） Chain B 240–448（209 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；0.1M Hepes pH7.5 10% v/v polyethylene glycol 8000 8% v/v ethylene glycol	Resolution 2.60 Å R-free 0.260
5XJE Crystal structure of fucosylated IgG1 Fc complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa Deposited 2017-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Fragment：UNP RESIDUES 227-449 Chain B 227–449（223 aa） Fragment：UNP RESIDUES 227-449	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；12% PEG 20000, 0.1 M MES (pH 6.5), 4% Zwittergent 3-12	Resolution 2.40 Å R-free 0.281
5XJF Crystal structure of fucosylated IgG Fc Y296W mutant complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa Deposited 2017-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Fragment：UNP RESIDUES 227-449 Chain B 227–449（223 aa） Fragment：UNP RESIDUES 227-449	Mutation：Y298W Mutation：Y298W	CL CHLORIDE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；12% PEG 20000, 0.1 M MES (pH 6.5), 4% Zwittergent 3-14	Resolution 2.50 Å R-free 0.270
5XMH Crystal structure of an IgM rheumatoid factor YES8c in complex with IgG1 Fc Deposited 2017-05-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 239–446（208 aa） Fragment：UNP RESIDUES 239-446	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；Tris-HCl, sodium acetate, PEG 4000	Resolution 2.80 Å R-free 0.272
5XMH Crystal structure of an IgM rheumatoid factor YES8c in complex with IgG1 Fc Deposited 2017-05-15	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 239–446（208 aa） Fragment：UNP RESIDUES 239-446	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；Tris-HCl, sodium acetate, PEG 4000	Resolution 2.80 Å R-free 0.272
5Y56 Fc mutant (K392D/K409D/D399K) Deposited 2017-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–445（208 aa） Fragment：UNP residues 238-445 Chain B 238–445（208 aa） Fragment：UNP residues 238-445	Mutation：K392D/K409D/D399K Mutation：K392D/K409D/D399K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；1.5M (NH4)2SO4, 10% Glycerol, 0.1M Tris-Hcl (pH 7.5)	Resolution 2.65 Å R-free 0.298
5YC5 Crystal structure of human IgG-Fc in complex with aglycan and optimized Fc gamma receptor IIIa Deposited 2017-09-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 226–448（223 aa） Fragment：Fc fragment, UNP residues 226-448 Chain B 226–448（223 aa） Fragment：Fc fragment, UNP residues 226-448	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293.15 K；20mM Tris-HCl, 100mM NaCl, 14% PEG 3350	Resolution 2.71 Å R-free 0.273
6ARP Structure of a mutant Cetuximab Fab fragment Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 120–222（103 aa）	Not recorded	SO4 SULFATE ION × 3 GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM sodium citrate, 1.6 M ammonium sulfate, 5% glycerol	Resolution 1.70 Å R-free 0.197
6ARP Structure of a mutant Cetuximab Fab fragment Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 120–222（103 aa）	Not recorded	SO4 SULFATE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM sodium citrate, 1.6 M ammonium sulfate, 5% glycerol	Resolution 1.70 Å R-free 0.197
6ARU Structure of Cetuximab Fab mutant in complex with EGFR extracellular domain Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 120–222（103 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；150 mM ammonium sulfate, 16.5% PEG3350, 10 mM cadmium chloride, 100 mM imidazole, 5% glycerol	Resolution 3.20 Å R-free 0.267
6B70 Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain and insulin Deposited 2017-10-03	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton and homemade plunger	Resolution 3.70 Å
6B7Z Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11 heavy chain and FAB H11 light chain Deposited 2017-10-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton	Resolution 6.50 Å
6BF7 Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain Deposited 2017-10-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton	Resolution 6.50 Å
6BF9 Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain Deposited 2017-10-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton	Resolution 7.20 Å
6BFT Structure of Bevacizumab Fab mutant in complex with VEGF Deposited 2017-10-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 120–227（108 aa） Chain H 120–227（108 aa）	Not recorded	SO4 SULFATE ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；100 mM MES, 6.0, 225 mM ammonium sulfate, 13% PEG4000, 10% isopropanol	Resolution 2.55 Å R-free 0.220
6BGT Structure of Trastuzumab Fab mutant in complex with Her2 extracellular domain Deposited 2017-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；100 mM MES, pH 6.5, 18% PEG3350, 10% glycerol	Resolution 2.70 Å R-free 0.247
6BKB Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody AR3A Deposited 2017-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；293 K；20% (w/v) PEG 3500, 0.2M sodium-citrate	Resolution 2.80 Å R-free 0.267
6BKC Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody AR3B Deposited 2017-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293 K；20% (w/v) PEG 3500, 0.2M Li-chloride	Resolution 2.60 Å R-free 0.276
6BZ4 Human IgG1 lacking complement-dependent cytotoxicity: hu3S193 Fc mutant K322A Deposited 2017-12-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Chain B 239–446（208 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；PEG 6000, 0.1 M MES, 25% V/V ETHYLENE GLYCOL	Resolution 2.40 Å R-free 0.249
6DKJ human GIPR ECD and Fab complex Deposited 2018-05-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–222（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10% PEG 4000 and 20% isopropanol	Resolution 1.95 Å R-free 0.238
6DKJ human GIPR ECD and Fab complex Deposited 2018-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 109–222（114 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10% PEG 4000 and 20% isopropanol	Resolution 1.95 Å R-free 0.238
6EAQ Glycosylated FCGR3B / CD16b in complex with afucosylated IgG1 Fc Deposited 2018-08-03	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–446（220 aa） Chain B 227–446（220 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；pH 6.0 50 mM MES, 8% PEG3350 and 60 mM NaCl	Resolution 2.22 Å R-free 0.244
6FCZ Model of gC1q-Fc complex based on 7A EM map Deposited 2017-12-21	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain H 234–449（216 aa） Fragment：UNP residues 234-449 Chain K 234–449（216 aa） Fragment：UNP residues 234-449	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
6FGO Fc in complex with engineered calcium binding domain Z Deposited 2018-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 239–448（210 aa） Chain C 239–448（210 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 5 GOL GLYCEROL × 7 CA CALCIUM ION × 2 CL CHLORIDE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；24 % PEG3350, 0.1 M LiCl2, 0.1 M MES pH 6.0	Resolution 2.50 Å R-free 0.232
6FGO Fc in complex with engineered calcium binding domain Z Deposited 2018-01-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 239–448（210 aa） Chain D 239–448（210 aa）	Not recorded	GOL GLYCEROL × 8 CA CALCIUM ION × 2 CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；24 % PEG3350, 0.1 M LiCl2, 0.1 M MES pH 6.0	Resolution 2.50 Å R-free 0.232
6G1E BEAT Fc with improved heterodimerization (Q3A-D84.4Q) Deposited 2018-03-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 223–449（227 aa）	Mutation：L234A, L235A, Q347E, Y349A, L351F, S364T, T366V, K370T, T394D, V397L, D399E, D401Q, F405A, Y407S, K409R, T411R Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；CRYSTALS GROWN BY VAPOR DIFFUSION BY MIXING 12.0 MG/ML PROTEIN IN 10 MM HEPES PH8.0, 100 MM NACL, 1 MM EDTA, EQUALLY WITH 33.00 %(W/V) PEG 1500	Resolution 1.88 Å R-free 0.272
6IFJ Structure of bispecific Fc Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Mutation：E357K,K409R Mutation：K370E	GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291.15 K；0.1M Hepes, pH7.5, 12%(w/v) polyethylene glycol 3350	Resolution 2.40 Å R-free 0.231
6IQG X-ray crystal structure of Fc and peptide complex Deposited 2018-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 238–447（210 aa） Chain B 238–447（210 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.9；293 K；PEG 3350, KI	Resolution 3.00 Å R-free 0.273
6IQH X-ray crystal structure of covalent-bonded complex of Fc and peptide Deposited 2018-11-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 238–447（210 aa） Chain B 238–447（210 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.1 M CHES pH 10.0, 0.3M NaCl, 20% (w/v) PEG 8000	Resolution 3.00 Å R-free 0.293
6KA7 The complex structure of Human IgG Fc and its binding Repebody Deposited 2019-06-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 240–447（208 aa） Chain D 240–447（208 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Tris HCl, PEG 4000, Sodium chloride	Resolution 3.00 Å R-free 0.333
6MB3 Cryo-EM structure of the circumsporozoite protein of Plasmodium falciparum with a vaccine-elicited antibody reveals maturation of inter-antibody contacts Deposited 2018-08-29	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain A 109–223（115 aa） Chain B 109–223（115 aa） Chain C 109–223（115 aa） Chain D 109–223（115 aa） Chain F 109–223（115 aa） Chain G 109–223（115 aa） Chain H 109–223（115 aa） Chain I 109–223（115 aa） Chain J 109–223（115 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
6MSY Anti-HIV-1 Fab Fab 2G12 + Man4 re-refinement Deposited 2018-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–221（102 aa）	Not recorded	UNX UNKNOWN LIGAND × 8 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；295 K；27% Peg 4000, 0.05M sodium acetate	Resolution 2.00 Å R-free 0.242
6MU3 Anti-HIV-1 Fab 2G12 + Man7 re-refinement Deposited 2018-10-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–221（102 aa） Chain M 120–221（102 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；295 K；20% Peg 4000, 0.2M sodium tartrate	Resolution 2.33 Å R-free 0.234
6MUB Anti-HIV-1 Fab 2G12 + Man5 re-refinement Deposited 2018-10-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–222（103 aa） Chain M 120–222（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.8；295 K；1.6M sodium/potassium phosphate	Resolution 2.50 Å R-free 0.280
6N2X Anti-HIV-1 Fab 2G12 + Man9 re-refinement Deposited 2018-11-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–220（101 aa） Chain M 120–220（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；25% Peg 400, 0.2M imidazole malate	Resolution 3.00 Å R-free 0.283
6N32 Anti-HIV-1 Fab 2G12 re-refinement Deposited 2018-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–221（102 aa） Chain K 120–221（102 aa）	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.05M ammonium sulfate, 18% Peg 6000, 0.1M imidazole malate	Resolution 2.20 Å R-free 0.227
6N35 Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement Deposited 2018-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–220（101 aa） Chain M 120–220（101 aa）	Not recorded	BEZ BENZOIC ACID × 1 GOL GLYCEROL × 1 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；2M Sodium/Potassium Phosphate	Resolution 1.75 Å R-free 0.238
6OGE Cryo-EM structure of Her2 extracellular domain-Trastuzumab Fab-Pertuzumab Fab complex Deposited 2019-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.36 Å
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 109–226（118 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 109–226（118 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 109–226（118 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6UBI N123-VRC34.05 HIV neutralizing antibody in complex with HIV fusion peptide residue 512-519 Deposited 2019-09-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 117–226（110 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M HEPES, pH 7, 30% PEG6000	Resolution 1.90 Å R-free 0.288
6UBI N123-VRC34.05 HIV neutralizing antibody in complex with HIV fusion peptide residue 512-519 Deposited 2019-09-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 117–226（110 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M HEPES, pH 7, 30% PEG6000	Resolution 1.90 Å R-free 0.288
6UGW Crystal structure of the Fc fragment of PF06438179/GP1111 an infliximab biosimilar in a C-centered orthorhombic crystal form, Lot A Deposited 2019-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 220–449（230 aa） Fragment：LotA_Fc	Not recorded	ZN ZINC ION × 6 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10 mg/mL protein with JCSG+ E7 (266849e7): 10% 2-propanol, 200 mM zinc acetate, 100 mM sodium cacodylate, pH 6.5, cryoprotectant: 20% ethylene glycol, puckID kux1-2	Resolution 2.00 Å R-free 0.219
6UGX Crystal structure of the Fc fragment of PF06438179/GP1111 an infliximab biosimilar in a primative orthorhombic crystal form, Lot A Deposited 2019-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 220–449（230 aa） Chain B 220–449（230 aa）	Not recorded	K POTASSIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10 mg/mL protein with 200 mM potassium nitrate, 20% PEG3350, cryoprotectant: 20% ethylene glycol, puckID sxt1-6	Resolution 2.10 Å R-free 0.256
6UGY Crystal structure of the Fc fragment of anti-TNFa antibody infliximab (Remicade) in a primative orthorhombic crystal form, Lot C Deposited 2019-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 220–449（230 aa） Fragment：LotC_Fc	Not recorded	ZN ZINC ION × 6 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10 mg/mL protein with JCSG+ E7 Opt screen H2 (267146h2): 4% 2-propanol, 200 mM zinc acetate, 100 mM sodium cacodylate, pH 6.8, cryoprotectant: 20% ethylene glycol, puckID kux1-9	Resolution 2.10 Å R-free 0.228
6UOE 3-25 Fab germline-reversion variant bound to an HCMV gB-derived peptide Deposited 2019-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–223（115 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.1 M magnesium chloride, 13.4% PEG3350, 16.75% PEG400, 0.1 M Tris, pH 8.5	Resolution 1.80 Å R-free 0.186
6V8Z VRC03 and 10-1074 Bound BG505 F14 HIV-1 SOSIP Envelope Trimer Structure Deposited 2019-12-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 117–220（104 aa） Chain I 117–220（104 aa） Chain O 117–220（104 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6VSL Crystal structure of a human fucosylated IgG1 Fc expressed in tobacco plants (Nicotiana benthamiana) Deposited 2020-02-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446) Chain B 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446)	Not recorded	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；15% PEG4000, 0.1 M HEPES, pH 7.0	Resolution 2.10 Å R-free 0.250
6VSZ Crystal structure of a human afucosylated IgG1 Fc expressed in tobacco plants (Nicotiana benthamiana) Deposited 2020-02-12	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446) Chain B 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；15% PEG4000, 0.1 M HEPES, pH 7.0	Resolution 2.60 Å R-free 0.276
6X3I NNAS Fc mutant Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 227–449（223 aa） Fragment：Fc	Not recorded	BMA beta-D-mannopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；30% polyethylene glycol 1500	Resolution 2.27 Å R-free 0.221
6YSC GLYCOSYLATED KNOB-HOLE/DUMMY FC FRAGMENT Deposited 2020-04-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 223–449（227 aa） Chain B 223–449（227 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；294 K；15% (w/v) PEG4000, 0.1M HEPES	Resolution 2.05 Å R-free 0.293
6YT7 GLYCOSYLATED KNOB/DUMMY-HOLE FC FRAGMENT Deposited 2020-04-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 223–449（227 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；294 K；25% (w/v) PEG2000 MME, 0.1M HEPES	Resolution 1.55 Å R-free 0.273
6YTB GLYCOSYLATED KNOB/DUMMY-HOLE/DUMMY FC FRAGMENT Deposited 2020-04-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 223–449（227 aa） Chain B 223–449（227 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；20% (w/v) PEG3350, 0.2M potassium formate	Resolution 1.65 Å R-free 0.249
7CZQ S protein of SARS-CoV-2 in complex bound with P2B-1A10 Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 115–449（335 aa） Chain J 115–449（335 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7CZT S protein of SARS-CoV-2 in complex bound with P5A-2G9 Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 109–449（341 aa） Chain I 109–449（341 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
7CZU S protein of SARS-CoV-2 in complex bound with P5A-1B6_2B Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 109–449（341 aa） Chain J 109–449（341 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7CZV S protein of SARS-CoV-2 in complex bound with P5A-1B6_3B Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 109–449（341 aa） Chain I 109–449（341 aa） Chain J 109–449（341 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 540 PDB declaration: 540-meric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 54 PDB declaration: 54-meric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7URU Crystal structure of the low affinity Fc gamma receptor IIIA variant in complex with the Fc of IgG1. Deposited 2022-04-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；8% PEG 8000 0.1 M HEPES pH 7.0	Resolution 2.40 Å R-free 0.262
7X13 Structure of IgG-Fc hexamer Deposited 2022-02-23	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 223–443（221 aa） Chain B 223–443（221 aa） Chain C 223–443（221 aa） Chain D 223–443（221 aa） Chain E 223–443（221 aa） Chain F 223–443（221 aa） Chain G 223–443（221 aa） Chain H 223–443（221 aa） Chain I 223–443（221 aa） Chain J 223–443（221 aa） Chain K 223–443（221 aa） Chain L 223–443（221 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8DAO Crystal structure of SARS-CoV-2 spike stem fusion peptide in complex with neutralizing antibody COV44-79 Deposited 2022-06-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 120–222（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1 M Tris, pH 8.5, 0.01 M nickel (II) chloride, and 20% PEG monomethyl ether 2000	Resolution 2.80 Å R-free 0.284
8DAO Crystal structure of SARS-CoV-2 spike stem fusion peptide in complex with neutralizing antibody COV44-79 Deposited 2022-06-13	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain G 120–222（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1 M Tris, pH 8.5, 0.01 M nickel (II) chloride, and 20% PEG monomethyl ether 2000	Resolution 2.80 Å R-free 0.284
8DBZ CryoEM structure of Hantavirus ANDV Gn(H) protein complex with 2Fabs ANDV-5 and ANDV-34 Deposited 2022-06-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 120–222（103 aa） Fragment：UNP residues 120-222 Chain H 120–222（103 aa） Fragment：UNP residues 120-222	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8DV1 SARS-CoV-2 Wuhan-hu-1-Spike-RBD bound to linker variant of affinity matured ACE2 mimetic CVD432 Deposited 2022-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 218–449（232 aa）	Mutation：K31F,N33D,H34S,E35Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8DV2 SARS-CoV-2 Wuhan-hu-1-Spike-RBD bound to computationally engineered ACE2 mimetic CVD293 Deposited 2022-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 218–449（232 aa）	Mutation：K31F,H34I,E35Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8ECQ Bovine Fab 2G3 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 115–222（108 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277.15 K；10% glycerol, 0.1M Mes, 5% Peg1000, 30% Peg600	Resolution 2.00 Å R-free 0.253
8ECV Bovine Fab 2F12 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 114–222（109 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293.15 K；0.2M sodium chloride, 0.1M phosphate-citrate buffer, 20% Peg6000	Resolution 1.81 Å R-free 0.261
8ECV Bovine Fab 2F12 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 114–222（109 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293.15 K；0.2M sodium chloride, 0.1M phosphate-citrate buffer, 20% Peg6000	Resolution 1.81 Å R-free 0.261
8ECZ Bovine Fab 4C1 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 114–222（109 aa）	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1M Tris, 50% MPD, 0.2M ammonium dihydrogen phosphate	Resolution 2.82 Å R-free 0.258
8ECZ Bovine Fab 4C1 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 114–222（109 aa）	Not recorded	PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1M Tris, 50% MPD, 0.2M ammonium dihydrogen phosphate	Resolution 2.82 Å R-free 0.258
8ED1 Bovine Fab 5C1 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 114–222（109 aa）	Not recorded	GOL GLYCEROL × 3 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277.15 K；0.1M Tris, 10% glycerol, 20% Peg300, 5% Peg8000	Resolution 2.31 Å R-free 0.267
8EDF Bovine Fab SKD in complex with Sars COV-2 receptor binding domain Deposited 2022-09-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 114–222（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293.15 K；0.4M Lithium chloride, 10% Peg6000, 0.1M sodium citrate	Resolution 3.40 Å R-free 0.299
8GHR Structure of human ENPP1 in complex with variable heavy domain VH27.2 Deposited 2023-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Not recorded	ZN ZINC ION × 4 AMP ADENOSINE MONOPHOSPHATE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；phosphate buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8TTM IgG1 Fc Heterodimer combYSelect1 Deposited 2023-08-14	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Mutation：K409S, T411Y Mutation：L368S, D399Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.1M BisTris pH 6.5 and 21% PEG MME 5000	Resolution 2.51 Å R-free 0.242
8TUD IgG1 Fc Heterodimer combYSelect2 Deposited 2023-08-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Mutation：D399Y, K447S Mutation：K409S, T411Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.1M Bis Tris pH 6.5 and 29% PEG MME 2000	Resolution 3.00 Å R-free 0.285
8URO Crystal structure of IgG1-Fc fragment (E382S) in complex with Corynebacterial ENGase CU43 (D187A-E189A) Deposited 2023-10-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 218–449（232 aa） Chain C 218–449（232 aa）	Mutation：E382S Mutation：E382S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Ammonium acetate 0.1 M MES 6.5 30 %v/v Glycerol ethoxylate (MIDAS 2-31)	Resolution 3.62 Å R-free 0.369
8URO Crystal structure of IgG1-Fc fragment (E382S) in complex with Corynebacterial ENGase CU43 (D187A-E189A) Deposited 2023-10-26	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 218–449（232 aa） Chain F 218–449（232 aa）	Mutation：E382S Mutation：E382S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Ammonium acetate 0.1 M MES 6.5 30 %v/v Glycerol ethoxylate (MIDAS 2-31)	Resolution 3.62 Å R-free 0.369
8W4L Crystal structure of closed conformation of human immunoglobulin Fc in presence of EndoSz Deposited 2023-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；100 mM MES PH 6.0 200 mM Zinc acetate 10 % PEG 8000	Resolution 3.10 Å R-free 0.257
8W4M Crystal structure of open conformation of human immunoglobulin Fc in presence of EndoSz Deposited 2023-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 227–449（223 aa）	Not recorded	ZN ZINC ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；100 mM MES PH 6.5 200 mM Zinc acetate 10 % PEG 8000	Resolution 2.18 Å R-free 0.255
8ZCK Serial Femtosecond Crystallography Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-04-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 2.00 Å R-free 0.227
8ZCL Ambient Temperature Crystal Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-04-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 2.60 Å R-free 0.236
8ZCM Cryogenic Temperature Crystal Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-04-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 2.64 Å R-free 0.409
9BEX X-ray crystallography structural model of the immunoglobulin G1 (IgG1) Fc D270C K326C variant Deposited 2024-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain AAA 218–449（232 aa） Chain BBB 218–449（232 aa）	Mutation：D270C,K326C Mutation：D270C,K326C	PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.1M HEPES pH 7.5, 10% PEG 3350	Resolution 2.25 Å R-free 0.302
9CRT Crystal structure of IgG1 FC at natural pH Deposited 2024-07-22	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.1 M Hepes pH 7.5 and 20% PEG 20,000	Resolution 2.19 Å R-free 0.282
9CXL Crystal structure of IgG1 FC WT at pH 5.5 Deposited 2024-07-31	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；1 M Ammonium sulfate, 0.1 M Sodium citrate pH 5.5	Resolution 2.33 Å R-free 0.279
9CY6 Crystal structure of IgG1 FC M252H at pH 7.5 Deposited 2024-08-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252H Mutation：M252H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 M Bis-tris propane pH 7.5, and 8% PEG8K	Resolution 2.06 Å R-free 0.282
9D06 Crystal structure of IgG1 FC M252R at pH 5.6 Deposited 2024-08-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252R Mutation：M252R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；0.1M Sodium citrate pH 5.6, 20% Propanol and 20% PEG 4K	Resolution 2.33 Å R-free 0.279
9D09 Crystal structure of IgG1 FC M252H at pH 5.6 Deposited 2024-08-06	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252H Mutation：M252H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；0.1M Sodium citrate pH 5.6, 20% Propanol and 20% PEG 4000	Resolution 2.92 Å R-free 0.283
9D9Q Crystal structure of IgG1 FC M252R at pH 8.0 Deposited 2024-08-21	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252R Mutation：M252R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 M Tris pH 8.0 and 0.08M Sodium formate and 7.5% PEG20K	Resolution 2.82 Å R-free 0.367
9DAZ Molecular basis of pathogenicity of the recently emerged FCoV-23 coronavirus. Complex of fAPN with FCoV-23 RBD Deposited 2024-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 218–449（232 aa） Chain C 218–449（232 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9IIE Cryogenic Temperature Crystal Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-06-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 3.14 Å R-free 0.309
9K2Y Human IgG1 Fc fragments, mutant (2CT1.1) Deposited 2024-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 227–449（223 aa） Chain B 227–449（223 aa） Chain C 227–449（223 aa） Chain D 227–449（223 aa）	Not recorded	GAL beta-D-galactopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；50mM Sodium phosphate pH 7.0, 16% PEG 3350	Resolution 3.12 Å R-free 0.281
9K34 Human IgG1 Fc fragments, mutant (2CT1.9) Deposited 2024-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 227–449（223 aa） Chain B 227–449（223 aa） Chain C 227–449（223 aa） Chain D 227–449（223 aa）	Not recorded	FUL beta-L-fucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；50mM HEPES pH 7.0, 10% PEG 3350	Resolution 3.00 Å R-free 0.279
9KHH Structure of the complex of LGR4 with Norrin (2:2) Deposited 2024-11-10	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 220–449（230 aa） Chain F 220–449（230 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9LOC Cryo-EM structure of human FcRL5 bound to IgG-Fc Deposited 2025-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: 13-meric	Chain B 218–443（226 aa） Chain C 218–443（226 aa） Chain D 218–443（226 aa） Chain E 218–443（226 aa） Chain F 218–443（226 aa） Chain G 218–443（226 aa） Chain H 218–443（226 aa） Chain I 218–443（226 aa） Chain J 218–443（226 aa） Chain K 218–443（226 aa） Chain L 218–443（226 aa） Chain M 218–443（226 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 13	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.56 Å
9LOD Local structure of human FcRL5 bound to IgG-Fc Deposited 2025-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 218–443（226 aa） Chain C 218–443（226 aa） Chain D 218–443（226 aa） Chain E 218–443（226 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
9MCX CRYSTAL STRUCTURE OF HUMAN IGG1 FC FRAGMENT-FC-GAMMA RECEPTOR IIA COMPLEX H131 VARIANT Deposited 2024-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；25% PEG 2000 MME, 0.1 M HEPES pH 7.5	Resolution 2.38 Å R-free 0.234
9MCY CRYSTAL STRUCTURE OF HUMAN IGG1 FC FRAGMENT-FC-GAMMA RECEPTOR IIA COMPLEX R131 VARIANT Deposited 2024-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；294 K；10% PEG 5000 MME, 12% isopropanol , 0.1 M MES pH 6.5	Resolution 2.85 Å R-free 0.236
9MCY CRYSTAL STRUCTURE OF HUMAN IGG1 FC FRAGMENT-FC-GAMMA RECEPTOR IIA COMPLEX R131 VARIANT Deposited 2024-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 227–449（223 aa） Chain D 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；294 K；10% PEG 5000 MME, 12% isopropanol , 0.1 M MES pH 6.5	Resolution 2.85 Å R-free 0.236
9OUV Crystal structure of human IGG1 FC fragment-FC-gamma receptor IIB complex Deposited 2025-05-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；150 mM sodium chloride 100 mM Tris-HCl pH 8.0 8% PEG 6000	Resolution 3.07 Å R-free 0.241
9UO5 Cryo-EM structure of the human IgG-Fc hexamer Deposited 2025-04-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 218–443（226 aa） Chain B 218–443（226 aa） Chain C 218–443（226 aa） Chain D 218–443（226 aa） Chain E 218–443（226 aa） Chain F 218–443（226 aa） Chain G 218–443（226 aa） Chain H 218–443（226 aa） Chain I 218–443（226 aa） Chain J 218–443（226 aa） Chain K 218–443（226 aa） Chain L 218–443（226 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.75 Å
9UOK Structure of the complex of LGR4_ECD with Norrin Deposited 2025-04-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 220–449（230 aa） Chain F 220–449（230 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.05 Å

105 other PDB entries and 128 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IGG1_HUMAN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain J； PDBConstruct 112–226； UniProt 109–223 Author chain K； PDBConstruct 112–226； UniProt 109–223 Author chain N； PDBConstruct 112–226； UniProt 109–223

IGL@ protein

Homo sapiens

UniProt Q6GMX4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 15 PDB declaration: pentadecameric（15） Consistent with protein copy count	Chain L； UniProt 20–236 Chain M； UniProt 20–236 Chain O； UniProt 20–236	Not recorded	Fusion glycoprotein F0,Envelope glycoprotein × 3 （C3UPB8,M1E1E4） AM22 Fab Heavy Chain,IGH@ protein × 3 （Q6GMX6） AM22 Fab Light Chain,Uncharacterized protein × 3 （Q8TCD0） Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain × 3 （A0A0B4J1V1,P0DOX5）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 6APD	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 140–234（95 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain M 140–234（95 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain N 140–234（95 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
4D9L Fab structure of anti-HIV-1 gp120 V2 mAb 697 Deposited 2012-01-11	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain O 140–234（95 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；296 K；18% polyethylene glycol 8000 and 0.1 M Tris pH 8.5 , VAPOR DIFFUSION, HANGING DROP, temperature 296K	Resolution 2.48 Å R-free 0.238
5W6C UCA Fab (unbound) from 6649 Lineage Deposited 2017-06-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 136–236（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；293.15 K；26% PEG2000 MME, 150 mM ammonium sulfate, 100 mM sodium acetate, pH 4.6	Resolution 1.63 Å R-free 0.201
5W6G Human antibody 6649 in complex with influenza hemagglutinin H1 Solomon Islands Deposited 2017-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 12 PDB declaration: dodecameric	Chain L 136–236（101 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 12 SO4 SULFATE ION × 18 GOL GLYCEROL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7；293.15 K；1.9 M ammonium sulfate, 0.1 M of HEPES, pH 7	Resolution 2.79 Å R-free 0.253
6APC Crystal Structure of Infant Antibody ADI-19425 Deposited 2017-08-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 20–236（217 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；50 nL of ADI-19425 Fab at 8.78 mg/ml, 50 nL of crystal seed solution, and 100 nL of reservoir solution containing 1.5 M Ammonium sulfate, 0.1 M sodium chloride, and 0.1 M BisTris pH 6.5	Resolution 1.70 Å R-free 0.204

4 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q6GMX4_HUMAN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–218； UniProt 20–236 Author chain M； PDBConstruct 1–218； UniProt 20–236 Author chain O； PDBConstruct 1–218； UniProt 20–236

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	6apd
Deposition date deposition_date	2017-08-17
Structure title title	Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425
Keywords keywords	viral glycoprotein, immunoglobulin, infant, complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	61.05 Å
Radius of gyration Rg (electron density) rg_electron	60.80 Å
Forward intensity I(0) i0	2567930000.00
Molecular weight molecular_weight	426830.0 kDa
Excluded volume excluded_volume	534620 Å³
Envelope volume envelope_volume	816100 Å³
Hydration-shell volume shell_volume	112580 Å³
Envelope diameter envelope_diameter	195.4 Å
Shell Rg shell_rg	60.61 Å
Envelope Rg envelope_rg	60.66 Å
Shape Rg shape_rg	60.82 Å
Total Rg total_rg	60.74 Å
Total atoms total_atoms	30005
Residues n_residues	3887
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	192.2 Å
Rg (real space) rg_real	60.86 Å
Rg uncertainty (real space) rg_real_error	1.45 Å
I(0) (real space) i0_real	2.5680e+09
I(0) uncertainty (real space) i0_real_error	5.1600e+07
Rg (reciprocal space) rg_reciprocal	61.18 Å
I(0) (reciprocal space) i0_reciprocal	2569000000.0000
Solution quality estimate total_estimate	0.6294
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	81.3 Å
Skewness Skewness skewness	0.160
Kurtosis Kurtosis kurtosis	-0.523
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	147900000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.953; Stabil: 1.000; Sysdev: 0.025; Positv: 1.000; Valcen: 0.985; Smooth: 0.260

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Fusion glycoprotein F0,Envelope glycoprotein
Molecular weight formula_weight	63775.9 kDa
Mutation mutation	N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V,N67I, P129A, S215P, I379V, M447V
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	30005

MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKEIKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSIPNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLSAIGGYIPEAPRDGQAYVRKDGEWVLLSTFLGSMEVLFQGPGHHHHHHHHSAWSHPQFEK

来源 Source

来源生物 organism	Human immunodeficiency virus 1
NCBI Class编号 ncbi_taxonomy_id	11676
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	AM22 Fab Heavy Chain,IGH@ protein
Molecular weight formula_weight	24123.2 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,F,H

QVQLVQSGAEVKKPGATVKVSCKISGHTLIKLSIHWVRQAPGKGLEWMGGYEGEVDEIFYAQKFQHRLTVIADTATDTVYMELGRLTSDDTAVYFCGTLGVTVTEAGLGIDDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	AM22 Fab Light Chain,Uncharacterized protein
Molecular weight formula_weight	23305.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,G,I

EIVLTQSPGTLSLSPGERATLSCRASQIVSRNHLAWYQQKPGQAPRLLIFGASSRATGIPVRFSGSGSGTDFTLTINGLAPEDFAVYYCLSSDSSIFTFGQGTKVDFKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain
Molecular weight formula_weight	23881.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K,N

EVQLVESGGGLVKPGGSLRLSCAASGFTFSSYSMNWVRQAPGKGLEWVSSISSSSSYIYYADSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCARLGYCSGGSCHFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	IGL@ protein
Molecular weight formula_weight	22955.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,M,O

QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGFYVFGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	Human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

▶

8. Citations (1)

▶

Unit-cell length a length_a	229.470 Å
Unit-cell length b length_b	229.470 Å
Unit-cell length c length_c	304.050 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	4.100 Å
Low-resolution limit resolution_low	50.958 Å
R factor r_factor	0.2063
R_work r_work	0.2037
R_free r_free	0.2562

fit	/app/data/saxs_computation/ap/6apd/6apd.fit
pddf	/app/data/pr_computation/ap/6apd/6apd.pr.out
profile	/app/data/saxs_computation/ap/6apd/6apd.dat

Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425

1. Protein Identity and Related Structures Protein Identity & Related Structures

Fusion glycoprotein F0,Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Fusion glycoprotein F0,Envelope glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

AM22 Fab Heavy Chain,IGH@ protein

State in the Current Structure

Other States of the Same Protein in the Database

AM22 Fab Light Chain,Uncharacterized protein

State in the Current Structure

Other States of the Same Protein in the Database

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Immunoglobulin heavy variable 3-21,Immunoglobulin gamma-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

IGL@ protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

来源 Source

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)