9uok

Structure of the complex of LGR4_ECD with Norrin

Method: ELECTRON MICROSCOPY D_max: 118.8 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leucine-rich repeat-containing G-protein coupled receptor 4

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain C； UniProt 24–951	Not recorded	MB52 × 1 Norrin,Immunoglobulin gamma-1 heavy chain × 2 （Q00604,P0DOX5）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.05 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9UOK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4KT1 Complex of R-spondin 1 with LGR4 extracellular domain Deposited 2013-05-19	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 26–527（502 aa） Fragment：UNP residues 26-502	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；291 K；PEG, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 291K	Resolution 2.50 Å R-free 0.209
4QXE Crystal structure of LGR4 fused with hagfish VLR Deposited 2014-07-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 27–396（370 aa） Fragment：R-spondin Receptor, UNP residues 27-396, UNP residues 133-200	Mutation：D75G	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 GOL GLYCEROL × 1 CL CHLORIDE ION × 2 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；289 K；0.1M HEPES pH 7.5, 2.0M ammonium sulfate, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.20 Å R-free 0.237
4QXF crystal structure of human LGR4 and Rspo1 Deposited 2014-07-20	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 27–252（226 aa） Fragment：UNP residues 27-252, UNP residues 128-200	Mutation：D75G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；0.1M MES pH 6.5, 0.2M sodium thiocyanate, 22% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.25 Å R-free 0.243
4QXF crystal structure of human LGR4 and Rspo1 Deposited 2014-07-20	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 27–252（226 aa） Fragment：UNP residues 27-252, UNP residues 128-200	Mutation：D75G	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；0.1M MES pH 6.5, 0.2M sodium thiocyanate, 22% PEG3350, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 2.25 Å R-free 0.243
8WVU Cryo-EM structure of LGR4 in complex with Rspo1 and RNF43 Deposited 2023-10-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 24–832（809 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen PROPANE	Resolution 3.61 Å
8WVV Cryo-EM structure of LGR4 in state I Deposited 2023-10-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–832（809 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen PROPANE	Resolution 3.35 Å
8WVW Cryo-EM structure of LGR4 in state II Deposited 2023-10-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 24–832（809 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen PROPANE	Resolution 3.53 Å
8WVX Cryo-EM structure of LGR4 in complex with Norrin(dimer) Deposited 2023-10-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 24–832（809 aa） Chain B 24–832（809 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen PROPANE	Resolution 3.32 Å
8WVY Cryo-EM structure of LGR4 in complex with Norrin Deposited 2023-10-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 24–832（809 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen PROPANE	Resolution 3.29 Å
8XFP the pentamerA complex of LGR4-RSPO2-ZNRF3(delta RING) Deposited 2023-12-14	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–951（951 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8XFS LGR4-RSPO2-ZNRF3 RING domain (1:2:2) Deposited 2023-12-14	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 31–821（791 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8XFT LGR4-RSPO2-ZNRF3(1:1:1) Deposited 2023-12-14	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–951（951 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.24 Å
8XT9 structure of LGR4 Deposited 2024-01-10	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–951（951 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8XUM Structure of LGR4 with RSPO2 Deposited 2024-01-13	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–951（951 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8Y69 LGR4-RSPO2-ZNRF3 (2:2:2) Deposited 2024-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 33–820（788 aa） Chain D 33–820（788 aa）	Not recorded	CLR CHOLESTEROL × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.38 Å
9KB6 Cryo-EM structure of LGR4 Deposited 2024-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–822（822 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.53 Å
9KB7 Cryo-EM structure of LGR4-RSPO2 complex Deposited 2024-10-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–822（822 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.97 Å
9KB8 Cryo-EM structure of LGR4-RSPO2-ZNRF3 complex (1:1:2) Deposited 2024-10-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–822（822 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.25 Å
9KB9 Cryo-EM structure of LGR4-RSPO2-ZNRF3 complex (2:2:2) Deposited 2024-10-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–822（822 aa） Chain D 1–822（822 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.59 Å
9KGK Structure of the complex of LGR4 with NB18 Deposited 2024-11-08	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–950（950 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.63 Å
9KHH Structure of the complex of LGR4 with Norrin (2:2) Deposited 2024-11-10	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 24–951（928 aa） Chain D 24–951（928 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9S37 Structure of LGR4 with NB21 Deposited 2025-07-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 32–823（792 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.94 Å
9S38 Structure of LGR4 with NB21 Deposited 2025-07-23	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 32–823（792 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.94 Å

22 other PDB entries and 23 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LGR4_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 16–943； UniProt 24–951

Norrin,Immunoglobulin gamma-1 heavy chain

Homo sapiens

UniProt P0DOX5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain E； UniProt 220–449 Chain F； UniProt 220–449	Not recorded	MB52 × 1 Leucine-rich repeat-containing G-protein coupled receptor 4 × 1 （Q9BXB1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.05 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9UOK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1D5B UNLIGANDED MATURE OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-06	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220) Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；25%PEG 1000, 100mM sodium acetate, 300mM CdCl2, 100mM ammonium sulfate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.285
1D5B UNLIGANDED MATURE OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-06	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；25%PEG 1000, 100mM sodium acetate, 300mM CdCl2, 100mM ammonium sulfate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.285
1D5B UNLIGANDED MATURE OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；25%PEG 1000, 100mM sodium acetate, 300mM CdCl2, 100mM ammonium sulfate, pH 4.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.285
1D5I UNLIGANDED GERMLINE PRECURSOR OF AN OXY-COPE CATALYTIC ANTIBODY Deposited 1999-10-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；75mM Hepes pH 7.0 9% PEG 4000 150 mM Ammonium Sulfate 20% 1,4 butanediol 100 mM Cadmium Chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.263
1D6V CONFORMATION EFFECTS IN BIOLOGICAL CATALYSIS INTRODUCED BY OXY-COPE ANTIBODY MATURATION Deposited 1999-10-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 120–220（101 aa） Fragment：chimeric fab fragment (UNP K7T9I5 residues 1-112, P0DOX5 residues 120-220)	Not recorded	CD CADMIUM ION × 4 HOP (1S,2S,5S)2-(4-GLUTARIDYLBENZYL)-5-PHENYL-1-CYCLOHEXANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；292 K；9% polyethylene glycol 4000 250mM ammonium sulfate 80mM Cadmium Chloride 75mM Hepes 20% 1,4 butanediol, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 19K	Resolution 2.00 Å R-free 0.264
1HZH CRYSTAL STRUCTURE OF THE INTACT HUMAN IGG B12 WITH BROAD AND POTENT ACTIVITY AGAINST PRIMARY HIV-1 ISOLATES: A TEMPLATE FOR HIV VACCINE DESIGN Deposited 2001-01-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 117–449（333 aa） Chain K 117–449（333 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295.5 K；NH4SO4, cacodylate, pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 2.70 Å R-free 0.273
1N0X Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope Deposited 2002-10-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain H 117–222（106 aa） Fragment：UNP residues 117-222 Chain K 117–222（106 aa） Fragment：UNP residues 117-222	Not recorded	GOL GLYCEROL × 8 SO4 SULFATE ION × 4 CXS 3-CYCLOHEXYL-1-PROPYLSULFONIC ACID × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.5；295.5 K；ammonium sulfate, lithium sulfate, CAPS buffer, pH 10.5, VAPOR DIFFUSION, SITTING DROP, temperature 295.5K	Resolution 1.80 Å R-free 0.252
3PGF Crystal structure of maltose bound MBP with a conformationally specific synthetic antigen binder (sAB) Deposited 2010-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 121–227（107 aa）	Not recorded	IMD IMIDAZOLE × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；292 K；19% PEG 3400, 8% Tacsimate, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 2.10 Å R-free 0.227
4R26 Crystal structure of human Fab PGT124, a broadly neutralizing and potent HIV-1 neutralizing antibody Deposited 2014-08-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 115–223（109 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；20% PEG 4000, 0.2M MgCl2, 0.1M Tris-HCL, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.267
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain Q 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain J 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
4R2G Crystal Structure of PGT124 Fab bound to HIV-1 JRCSF gp120 core and to CD4 Deposited 2014-08-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain N 115–223（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CL CHLORIDE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8；293 K；2.4M ammonium sulphate, 0.1M Tris, 13% glycerol, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.28 Å R-free 0.263
5O4E Crystal structure of VEGF in complex with heterodimeric Fcab JanusCT6 Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 227–449（223 aa） Chain B 227–449（223 aa） Chain C 227–448（222 aa） Chain D 227–449（223 aa）	Mutation：T350V, T366L, K392L, T394W Mutation：;T350V, L351Y, T359R, K360F, N361Y, E388D, N389I, F389a, P389b, N389c, G389d, L389e, F405A, Y407V, D413P, K414Y, S415P, R416S, Q418L, Q419M, N421T, V422R, S440H, S442E, L443Y, S444Q, P445W, G446P, K447T ; Mutation：T350V, T366L, K392L, T394W Mutation：;T350V, L351Y, T359R, K360F, N361Y, E388D, N389I, F389a, P389b, N389c, G389d, L389e, F405A, Y407V, D413P, K414Y, S415P, R416S, Q418L, Q419M, N421T, V422R, S440H, S442E, L443Y, S444Q, P445W, G446P, K447T ;	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 10 MRD (4R)-2-METHYLPENTANE-2,4-DIOL × 1 CAC CACODYLATE ION × 2 TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；295 K；0.1 M Sodium cacodylate, 40% (v/v) MPD, 5% (w/v) PEG 8000	Resolution 2.15 Å R-free 0.236
5VJ6 BG505 SOSIP.664 in complex with broadly neutralizing antibodies PG9 and 8ANC195 Deposited 2017-04-18	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain H 117–224（108 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 11.50 Å
5VU0 Crystal structure of the complex between afucosylated/galactosylated human IgG1 Fc and Fc gamma receptor IIIa (CD16A) with Man5 N-glycans Deposited 2017-05-18	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 230–446（217 aa） Fragment：Fc region (UNP residues 230-446) Chain B 230–446（217 aa） Fragment：Fc region (UNP residues 230-446)	Not recorded	EDO 1,2-ETHANEDIOL × 5 PEG DI(HYDROXYETHYL)ETHER × 4 NA SODIUM ION × 9 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM Bis-Tris Propane pH 7.5, 16% PEG 20k, 100 mM Potassium thiocyanate, Cryo protection - 20% Ethylene Glycol	Resolution 2.26 Å R-free 0.237
5VZX Crystal structure of crenezumab Fab Deposited 2017-05-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 115–227（113 aa） Chain H 115–227（113 aa）	Not recorded	SO4 SULFATE ION × 11 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.4 M ammonium sulfate, 0.1M HEPES pH 7.5	Resolution 2.50 Å R-free 0.230
5VZX Crystal structure of crenezumab Fab Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 115–227（113 aa）	Not recorded	SO4 SULFATE ION × 6 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.4 M ammonium sulfate, 0.1M HEPES pH 7.5	Resolution 2.50 Å R-free 0.230
5VZX Crystal structure of crenezumab Fab Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 115–227（113 aa）	Not recorded	SO4 SULFATE ION × 5 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；2.4 M ammonium sulfate, 0.1M HEPES pH 7.5	Resolution 2.50 Å R-free 0.230
5VZY Crystal structure of crenezumab Fab in complex with Abeta Deposited 2017-05-29	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 115–227（113 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；0.2 M magnesium chloride hexahydrate, 0.1 M Tris hydrochloride pH 8.5, 30% w/v polyethylene glycol 4000	Resolution 2.32 Å R-free 0.249
5W5L Crystal structure of human IgG1-Sigma Fc fragment Deposited 2017-06-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 227–449（223 aa） Fragment：Sigma Fc fragment, UNP residues 227-449 Chain B 227–449（223 aa） Fragment：Sigma Fc fragment, UNP residues 227-449	Mutation：L234A, L235A, A237G, P238S, H268A, A330S, P331S Mutation：L234A, L235A, A237G, P238S, H268A, A330S, P331S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；9% PEG 20,000, 0.1 M Sodium Acetate, pH 5.5	Resolution 1.90 Å R-free 0.229
5WAV Fc AbVance: Increasing our knowledge of antibody structural space to enable faster and better decision-making in antibody drug discovery. Deposited 2017-06-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 240–448（209 aa） Chain B 240–448（209 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；0.1M Hepes pH7.5 10% v/v polyethylene glycol 8000 8% v/v ethylene glycol	Resolution 2.60 Å R-free 0.260
5XJE Crystal structure of fucosylated IgG1 Fc complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa Deposited 2017-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Fragment：UNP RESIDUES 227-449 Chain B 227–449（223 aa） Fragment：UNP RESIDUES 227-449	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；12% PEG 20000, 0.1 M MES (pH 6.5), 4% Zwittergent 3-12	Resolution 2.40 Å R-free 0.281
5XJF Crystal structure of fucosylated IgG Fc Y296W mutant complexed with bis-glycosylated soluble form of Fc gamma receptor IIIa Deposited 2017-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Fragment：UNP RESIDUES 227-449 Chain B 227–449（223 aa） Fragment：UNP RESIDUES 227-449	Mutation：Y298W Mutation：Y298W	CL CHLORIDE ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；12% PEG 20000, 0.1 M MES (pH 6.5), 4% Zwittergent 3-14	Resolution 2.50 Å R-free 0.270
5XMH Crystal structure of an IgM rheumatoid factor YES8c in complex with IgG1 Fc Deposited 2017-05-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 239–446（208 aa） Fragment：UNP RESIDUES 239-446	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；Tris-HCl, sodium acetate, PEG 4000	Resolution 2.80 Å R-free 0.272
5XMH Crystal structure of an IgM rheumatoid factor YES8c in complex with IgG1 Fc Deposited 2017-05-15	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 239–446（208 aa） Fragment：UNP RESIDUES 239-446	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；Tris-HCl, sodium acetate, PEG 4000	Resolution 2.80 Å R-free 0.272
5Y56 Fc mutant (K392D/K409D/D399K) Deposited 2017-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–445（208 aa） Fragment：UNP residues 238-445 Chain B 238–445（208 aa） Fragment：UNP residues 238-445	Mutation：K392D/K409D/D399K Mutation：K392D/K409D/D399K	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；1.5M (NH4)2SO4, 10% Glycerol, 0.1M Tris-Hcl (pH 7.5)	Resolution 2.65 Å R-free 0.298
5YC5 Crystal structure of human IgG-Fc in complex with aglycan and optimized Fc gamma receptor IIIa Deposited 2017-09-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 226–448（223 aa） Fragment：Fc fragment, UNP residues 226-448 Chain B 226–448（223 aa） Fragment：Fc fragment, UNP residues 226-448	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；293.15 K；20mM Tris-HCl, 100mM NaCl, 14% PEG 3350	Resolution 2.71 Å R-free 0.273
6APD Crystal structure of RSV F bound by AM22 and the infant antibody ADI-19425 Deposited 2017-08-17	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 15 PDB declaration: pentadecameric	Chain J 109–223（115 aa） Chain K 109–223（115 aa） Chain N 109–223（115 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；10% PEG 4000 10% 2-propanol 0.1 M sodium citrate pH 5.5	Resolution 4.10 Å R-free 0.256
6ARP Structure of a mutant Cetuximab Fab fragment Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 120–222（103 aa）	Not recorded	SO4 SULFATE ION × 3 GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM sodium citrate, 1.6 M ammonium sulfate, 5% glycerol	Resolution 1.70 Å R-free 0.197
6ARP Structure of a mutant Cetuximab Fab fragment Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 120–222（103 aa）	Not recorded	SO4 SULFATE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；100 mM sodium citrate, 1.6 M ammonium sulfate, 5% glycerol	Resolution 1.70 Å R-free 0.197
6ARU Structure of Cetuximab Fab mutant in complex with EGFR extracellular domain Deposited 2017-08-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 120–222（103 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；150 mM ammonium sulfate, 16.5% PEG3350, 10 mM cadmium chloride, 100 mM imidazole, 5% glycerol	Resolution 3.20 Å R-free 0.267
6B70 Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain and insulin Deposited 2017-10-03	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton and homemade plunger	Resolution 3.70 Å
6B7Z Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11 heavy chain and FAB H11 light chain Deposited 2017-10-05	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton	Resolution 6.50 Å
6BF7 Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain Deposited 2017-10-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton	Resolution 6.50 Å
6BF9 Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy chain, FAB H11-E light chain Deposited 2017-10-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 125–219（95 aa） Chain E 125–219（95 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE；The cryo grids were made using Spotiton	Resolution 7.20 Å
6BFT Structure of Bevacizumab Fab mutant in complex with VEGF Deposited 2017-10-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 120–227（108 aa） Chain H 120–227（108 aa）	Not recorded	SO4 SULFATE ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；100 mM MES, 6.0, 225 mM ammonium sulfate, 13% PEG4000, 10% isopropanol	Resolution 2.55 Å R-free 0.220
6BGT Structure of Trastuzumab Fab mutant in complex with Her2 extracellular domain Deposited 2017-10-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；293 K；100 mM MES, pH 6.5, 18% PEG3350, 10% glycerol	Resolution 2.70 Å R-free 0.247
6BKB Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody AR3A Deposited 2017-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.2；293 K；20% (w/v) PEG 3500, 0.2M sodium-citrate	Resolution 2.80 Å R-free 0.267
6BKC Structure of Hepatitis C Virus Envelope Glycoprotein E2 core from genotype 6a bound to broadly neutralizing antibody AR3B Deposited 2017-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293 K；20% (w/v) PEG 3500, 0.2M Li-chloride	Resolution 2.60 Å R-free 0.276
6BZ4 Human IgG1 lacking complement-dependent cytotoxicity: hu3S193 Fc mutant K322A Deposited 2017-12-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Chain B 239–446（208 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；PEG 6000, 0.1 M MES, 25% V/V ETHYLENE GLYCOL	Resolution 2.40 Å R-free 0.249
6DKJ human GIPR ECD and Fab complex Deposited 2018-05-29	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–222（114 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10% PEG 4000 and 20% isopropanol	Resolution 1.95 Å R-free 0.238
6DKJ human GIPR ECD and Fab complex Deposited 2018-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 109–222（114 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；10% PEG 4000 and 20% isopropanol	Resolution 1.95 Å R-free 0.238
6EAQ Glycosylated FCGR3B / CD16b in complex with afucosylated IgG1 Fc Deposited 2018-08-03	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–446（220 aa） Chain B 227–446（220 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；pH 6.0 50 mM MES, 8% PEG3350 and 60 mM NaCl	Resolution 2.22 Å R-free 0.244
6FCZ Model of gC1q-Fc complex based on 7A EM map Deposited 2017-12-21	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain H 234–449（216 aa） Fragment：UNP residues 234-449 Chain K 234–449（216 aa） Fragment：UNP residues 234-449	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 10.00 Å
6FGO Fc in complex with engineered calcium binding domain Z Deposited 2018-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 239–448（210 aa） Chain C 239–448（210 aa）	Not recorded	PEG DI(HYDROXYETHYL)ETHER × 5 GOL GLYCEROL × 7 CA CALCIUM ION × 2 CL CHLORIDE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；24 % PEG3350, 0.1 M LiCl2, 0.1 M MES pH 6.0	Resolution 2.50 Å R-free 0.232
6FGO Fc in complex with engineered calcium binding domain Z Deposited 2018-01-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 239–448（210 aa） Chain D 239–448（210 aa）	Not recorded	GOL GLYCEROL × 8 CA CALCIUM ION × 2 CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；24 % PEG3350, 0.1 M LiCl2, 0.1 M MES pH 6.0	Resolution 2.50 Å R-free 0.232
6G1E BEAT Fc with improved heterodimerization (Q3A-D84.4Q) Deposited 2018-03-21	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 223–449（227 aa）	Mutation：L234A, L235A, Q347E, Y349A, L351F, S364T, T366V, K370T, T394D, V397L, D399E, D401Q, F405A, Y407S, K409R, T411R Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293.15 K；CRYSTALS GROWN BY VAPOR DIFFUSION BY MIXING 12.0 MG/ML PROTEIN IN 10 MM HEPES PH8.0, 100 MM NACL, 1 MM EDTA, EQUALLY WITH 33.00 %(W/V) PEG 1500	Resolution 1.88 Å R-free 0.272
6IFJ Structure of bispecific Fc Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Mutation：E357K,K409R Mutation：K370E	GOL GLYCEROL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；291.15 K；0.1M Hepes, pH7.5, 12%(w/v) polyethylene glycol 3350	Resolution 2.40 Å R-free 0.231
6IQG X-ray crystal structure of Fc and peptide complex Deposited 2018-11-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 238–447（210 aa） Chain B 238–447（210 aa）	Not recorded	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.9；293 K；PEG 3350, KI	Resolution 3.00 Å R-free 0.273
6IQH X-ray crystal structure of covalent-bonded complex of Fc and peptide Deposited 2018-11-08	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 238–447（210 aa） Chain B 238–447（210 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10；293 K；0.1 M CHES pH 10.0, 0.3M NaCl, 20% (w/v) PEG 8000	Resolution 3.00 Å R-free 0.293
6KA7 The complex structure of Human IgG Fc and its binding Repebody Deposited 2019-06-21	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 240–447（208 aa） Chain D 240–447（208 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Tris HCl, PEG 4000, Sodium chloride	Resolution 3.00 Å R-free 0.333
6MB3 Cryo-EM structure of the circumsporozoite protein of Plasmodium falciparum with a vaccine-elicited antibody reveals maturation of inter-antibody contacts Deposited 2018-08-29	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 19 PDB declaration: nonadecameric	Chain A 109–223（115 aa） Chain B 109–223（115 aa） Chain C 109–223（115 aa） Chain D 109–223（115 aa） Chain F 109–223（115 aa） Chain G 109–223（115 aa） Chain H 109–223（115 aa） Chain I 109–223（115 aa） Chain J 109–223（115 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
6MSY Anti-HIV-1 Fab Fab 2G12 + Man4 re-refinement Deposited 2018-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–221（102 aa）	Not recorded	UNX UNKNOWN LIGAND × 8 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；295 K；27% Peg 4000, 0.05M sodium acetate	Resolution 2.00 Å R-free 0.242
6MU3 Anti-HIV-1 Fab 2G12 + Man7 re-refinement Deposited 2018-10-22	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–221（102 aa） Chain M 120–221（102 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.6；295 K；20% Peg 4000, 0.2M sodium tartrate	Resolution 2.33 Å R-free 0.234
6MUB Anti-HIV-1 Fab 2G12 + Man5 re-refinement Deposited 2018-10-22	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–222（103 aa） Chain M 120–222（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.8；295 K；1.6M sodium/potassium phosphate	Resolution 2.50 Å R-free 0.280
6N2X Anti-HIV-1 Fab 2G12 + Man9 re-refinement Deposited 2018-11-14	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–220（101 aa） Chain M 120–220（101 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；25% Peg 400, 0.2M imidazole malate	Resolution 3.00 Å R-free 0.283
6N32 Anti-HIV-1 Fab 2G12 re-refinement Deposited 2018-11-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–221（102 aa） Chain K 120–221（102 aa）	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；298 K；1.05M ammonium sulfate, 18% Peg 6000, 0.1M imidazole malate	Resolution 2.20 Å R-free 0.227
6N35 Anti-HIV-1 Fab 2G12 + Man1-2 re-refinement Deposited 2018-11-14	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain H 120–220（101 aa） Chain M 120–220（101 aa）	Not recorded	BEZ BENZOIC ACID × 1 GOL GLYCEROL × 1 MAN alpha-D-mannopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；2M Sodium/Potassium Phosphate	Resolution 1.75 Å R-free 0.238
6OGE Cryo-EM structure of Her2 extracellular domain-Trastuzumab Fab-Pertuzumab Fab complex Deposited 2019-04-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain C 109–222（114 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.36 Å
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 109–226（118 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 109–226（118 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6OKQ Crystal structure of the SF12 Fab Deposited 2019-04-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 109–226（118 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；100 mM HEPES, pH 7.5, 1.8 M sodium formate	Resolution 3.20 Å R-free 0.299
6UBI N123-VRC34.05 HIV neutralizing antibody in complex with HIV fusion peptide residue 512-519 Deposited 2019-09-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 117–226（110 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M HEPES, pH 7, 30% PEG6000	Resolution 1.90 Å R-free 0.288
6UBI N123-VRC34.05 HIV neutralizing antibody in complex with HIV fusion peptide residue 512-519 Deposited 2019-09-11	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 117–226（110 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.1 M HEPES, pH 7, 30% PEG6000	Resolution 1.90 Å R-free 0.288
6UGW Crystal structure of the Fc fragment of PF06438179/GP1111 an infliximab biosimilar in a C-centered orthorhombic crystal form, Lot A Deposited 2019-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 220–449（230 aa） Fragment：LotA_Fc	Not recorded	ZN ZINC ION × 6 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10 mg/mL protein with JCSG+ E7 (266849e7): 10% 2-propanol, 200 mM zinc acetate, 100 mM sodium cacodylate, pH 6.5, cryoprotectant: 20% ethylene glycol, puckID kux1-2	Resolution 2.00 Å R-free 0.219
6UGX Crystal structure of the Fc fragment of PF06438179/GP1111 an infliximab biosimilar in a primative orthorhombic crystal form, Lot A Deposited 2019-09-26	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 220–449（230 aa） Chain B 220–449（230 aa）	Not recorded	K POTASSIUM ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10 mg/mL protein with 200 mM potassium nitrate, 20% PEG3350, cryoprotectant: 20% ethylene glycol, puckID sxt1-6	Resolution 2.10 Å R-free 0.256
6UGY Crystal structure of the Fc fragment of anti-TNFa antibody infliximab (Remicade) in a primative orthorhombic crystal form, Lot C Deposited 2019-09-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 220–449（230 aa） Fragment：LotC_Fc	Not recorded	ZN ZINC ION × 6 ACT ACETATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；10 mg/mL protein with JCSG+ E7 Opt screen H2 (267146h2): 4% 2-propanol, 200 mM zinc acetate, 100 mM sodium cacodylate, pH 6.8, cryoprotectant: 20% ethylene glycol, puckID kux1-9	Resolution 2.10 Å R-free 0.228
6UOE 3-25 Fab germline-reversion variant bound to an HCMV gB-derived peptide Deposited 2019-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 109–223（115 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；0.1 M magnesium chloride, 13.4% PEG3350, 16.75% PEG400, 0.1 M Tris, pH 8.5	Resolution 1.80 Å R-free 0.186
6V8Z VRC03 and 10-1074 Bound BG505 F14 HIV-1 SOSIP Envelope Trimer Structure Deposited 2019-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 18 PDB declaration: octadecameric	Chain C 117–220（104 aa） Chain I 117–220（104 aa） Chain O 117–220（104 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
6VSL Crystal structure of a human fucosylated IgG1 Fc expressed in tobacco plants (Nicotiana benthamiana) Deposited 2020-02-11	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446) Chain B 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446)	Not recorded	MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；15% PEG4000, 0.1 M HEPES, pH 7.0	Resolution 2.10 Å R-free 0.250
6VSZ Crystal structure of a human afucosylated IgG1 Fc expressed in tobacco plants (Nicotiana benthamiana) Deposited 2020-02-12	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446) Chain B 236–446（211 aa） Fragment：crystallizable fragment (UNP residues 236-446)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；15% PEG4000, 0.1 M HEPES, pH 7.0	Resolution 2.60 Å R-free 0.276
6X3I NNAS Fc mutant Deposited 2020-05-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 227–449（223 aa） Fragment：Fc	Not recorded	BMA beta-D-mannopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；30% polyethylene glycol 1500	Resolution 2.27 Å R-free 0.221
6YSC GLYCOSYLATED KNOB-HOLE/DUMMY FC FRAGMENT Deposited 2020-04-22	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 223–449（227 aa） Chain B 223–449（227 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；294 K；15% (w/v) PEG4000, 0.1M HEPES	Resolution 2.05 Å R-free 0.293
6YT7 GLYCOSYLATED KNOB/DUMMY-HOLE FC FRAGMENT Deposited 2020-04-24	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 223–449（227 aa）	Mutation：YES	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；294 K；25% (w/v) PEG2000 MME, 0.1M HEPES	Resolution 1.55 Å R-free 0.273
6YTB GLYCOSYLATED KNOB/DUMMY-HOLE/DUMMY FC FRAGMENT Deposited 2020-04-24	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 223–449（227 aa） Chain B 223–449（227 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；20% (w/v) PEG3350, 0.2M potassium formate	Resolution 1.65 Å R-free 0.249
7CZQ S protein of SARS-CoV-2 in complex bound with P2B-1A10 Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 115–449（335 aa） Chain J 115–449（335 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.80 Å
7CZT S protein of SARS-CoV-2 in complex bound with P5A-2G9 Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 109–449（341 aa） Chain I 109–449（341 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å
7CZU S protein of SARS-CoV-2 in complex bound with P5A-1B6_2B Deposited 2020-09-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain H 109–449（341 aa） Chain J 109–449（341 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 28	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7CZV S protein of SARS-CoV-2 in complex bound with P5A-1B6_3B Deposited 2020-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 109–449（341 aa） Chain I 109–449（341 aa） Chain J 109–449（341 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 31	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 540 PDB declaration: 540-meric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 45 PDB declaration: 45-meric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 54 PDB declaration: 54-meric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7T17 Zika Virus asymmetric unit bound with IgM antibody DH1017 Fab fragment Deposited 2021-12-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain H 120–224（105 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.26 Å
7URU Crystal structure of the low affinity Fc gamma receptor IIIA variant in complex with the Fc of IgG1. Deposited 2022-04-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；294 K；8% PEG 8000 0.1 M HEPES pH 7.0	Resolution 2.40 Å R-free 0.262
7X13 Structure of IgG-Fc hexamer Deposited 2022-02-23	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 223–443（221 aa） Chain B 223–443（221 aa） Chain C 223–443（221 aa） Chain D 223–443（221 aa） Chain E 223–443（221 aa） Chain F 223–443（221 aa） Chain G 223–443（221 aa） Chain H 223–443（221 aa） Chain I 223–443（221 aa） Chain J 223–443（221 aa） Chain K 223–443（221 aa） Chain L 223–443（221 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
8DAO Crystal structure of SARS-CoV-2 spike stem fusion peptide in complex with neutralizing antibody COV44-79 Deposited 2022-06-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 120–222（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1 M Tris, pH 8.5, 0.01 M nickel (II) chloride, and 20% PEG monomethyl ether 2000	Resolution 2.80 Å R-free 0.284
8DAO Crystal structure of SARS-CoV-2 spike stem fusion peptide in complex with neutralizing antibody COV44-79 Deposited 2022-06-13	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain G 120–222（103 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1 M Tris, pH 8.5, 0.01 M nickel (II) chloride, and 20% PEG monomethyl ether 2000	Resolution 2.80 Å R-free 0.284
8DBZ CryoEM structure of Hantavirus ANDV Gn(H) protein complex with 2Fabs ANDV-5 and ANDV-34 Deposited 2022-06-15	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain F 120–222（103 aa） Fragment：UNP residues 120-222 Chain H 120–222（103 aa） Fragment：UNP residues 120-222	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
8DV1 SARS-CoV-2 Wuhan-hu-1-Spike-RBD bound to linker variant of affinity matured ACE2 mimetic CVD432 Deposited 2022-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 218–449（232 aa）	Mutation：K31F,N33D,H34S,E35Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8DV2 SARS-CoV-2 Wuhan-hu-1-Spike-RBD bound to computationally engineered ACE2 mimetic CVD293 Deposited 2022-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 218–449（232 aa）	Mutation：K31F,H34I,E35Q	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8ECQ Bovine Fab 2G3 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 115–222（108 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	GOL GLYCEROL × 3 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277.15 K；10% glycerol, 0.1M Mes, 5% Peg1000, 30% Peg600	Resolution 2.00 Å R-free 0.253
8ECV Bovine Fab 2F12 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 114–222（109 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293.15 K；0.2M sodium chloride, 0.1M phosphate-citrate buffer, 20% Peg6000	Resolution 1.81 Å R-free 0.261
8ECV Bovine Fab 2F12 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 114–222（109 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293.15 K；0.2M sodium chloride, 0.1M phosphate-citrate buffer, 20% Peg6000	Resolution 1.81 Å R-free 0.261
8ECZ Bovine Fab 4C1 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 114–222（109 aa）	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1M Tris, 50% MPD, 0.2M ammonium dihydrogen phosphate	Resolution 2.82 Å R-free 0.258
8ECZ Bovine Fab 4C1 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 114–222（109 aa）	Not recorded	PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293.15 K；0.1M Tris, 50% MPD, 0.2M ammonium dihydrogen phosphate	Resolution 2.82 Å R-free 0.258
8ED1 Bovine Fab 5C1 Deposited 2022-09-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 114–222（109 aa）	Not recorded	GOL GLYCEROL × 3 PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277.15 K；0.1M Tris, 10% glycerol, 20% Peg300, 5% Peg8000	Resolution 2.31 Å R-free 0.267
8EDF Bovine Fab SKD in complex with Sars COV-2 receptor binding domain Deposited 2022-09-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain H 114–222（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.2；293.15 K；0.4M Lithium chloride, 10% Peg6000, 0.1M sodium citrate	Resolution 3.40 Å R-free 0.299
8GHR Structure of human ENPP1 in complex with variable heavy domain VH27.2 Deposited 2023-03-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Not recorded	ZN ZINC ION × 4 AMP ADENOSINE MONOPHOSPHATE × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 CA CALCIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；phosphate buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8TTM IgG1 Fc Heterodimer combYSelect1 Deposited 2023-08-14	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Mutation：K409S, T411Y Mutation：L368S, D399Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.1M BisTris pH 6.5 and 21% PEG MME 5000	Resolution 2.51 Å R-free 0.242
8TUD IgG1 Fc Heterodimer combYSelect2 Deposited 2023-08-16	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 218–449（232 aa） Chain B 218–449（232 aa）	Mutation：D399Y, K447S Mutation：K409S, T411Y	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；292 K；0.1M Bis Tris pH 6.5 and 29% PEG MME 2000	Resolution 3.00 Å R-free 0.285
8URO Crystal structure of IgG1-Fc fragment (E382S) in complex with Corynebacterial ENGase CU43 (D187A-E189A) Deposited 2023-10-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 218–449（232 aa） Chain C 218–449（232 aa）	Mutation：E382S Mutation：E382S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Ammonium acetate 0.1 M MES 6.5 30 %v/v Glycerol ethoxylate (MIDAS 2-31)	Resolution 3.62 Å R-free 0.369
8URO Crystal structure of IgG1-Fc fragment (E382S) in complex with Corynebacterial ENGase CU43 (D187A-E189A) Deposited 2023-10-26	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 218–449（232 aa） Chain F 218–449（232 aa）	Mutation：E382S Mutation：E382S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Ammonium acetate 0.1 M MES 6.5 30 %v/v Glycerol ethoxylate (MIDAS 2-31)	Resolution 3.62 Å R-free 0.369
8W4L Crystal structure of closed conformation of human immunoglobulin Fc in presence of EndoSz Deposited 2023-08-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；100 mM MES PH 6.0 200 mM Zinc acetate 10 % PEG 8000	Resolution 3.10 Å R-free 0.257
8W4M Crystal structure of open conformation of human immunoglobulin Fc in presence of EndoSz Deposited 2023-08-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Monomer；Protein × 1 PDB declaration: monomeric	Chain A 227–449（223 aa）	Not recorded	ZN ZINC ION × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；100 mM MES PH 6.5 200 mM Zinc acetate 10 % PEG 8000	Resolution 2.18 Å R-free 0.255
8ZCK Serial Femtosecond Crystallography Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-04-30	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 2.00 Å R-free 0.227
8ZCL Ambient Temperature Crystal Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-04-30	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 2.60 Å R-free 0.236
8ZCM Cryogenic Temperature Crystal Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-04-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions BATCH MODE；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 2.64 Å R-free 0.409
9BEX X-ray crystallography structural model of the immunoglobulin G1 (IgG1) Fc D270C K326C variant Deposited 2024-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain AAA 218–449（232 aa） Chain BBB 218–449（232 aa）	Mutation：D270C,K326C Mutation：D270C,K326C	PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.1M HEPES pH 7.5, 10% PEG 3350	Resolution 2.25 Å R-free 0.302
9CRT Crystal structure of IgG1 FC at natural pH Deposited 2024-07-22	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；0.1 M Hepes pH 7.5 and 20% PEG 20,000	Resolution 2.19 Å R-free 0.282
9CXL Crystal structure of IgG1 FC WT at pH 5.5 Deposited 2024-07-31	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；1 M Ammonium sulfate, 0.1 M Sodium citrate pH 5.5	Resolution 2.33 Å R-free 0.279
9CY6 Crystal structure of IgG1 FC M252H at pH 7.5 Deposited 2024-08-01	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252H Mutation：M252H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 M Bis-tris propane pH 7.5, and 8% PEG8K	Resolution 2.06 Å R-free 0.282
9D06 Crystal structure of IgG1 FC M252R at pH 5.6 Deposited 2024-08-06	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252R Mutation：M252R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；0.1M Sodium citrate pH 5.6, 20% Propanol and 20% PEG 4K	Resolution 2.33 Å R-free 0.279
9D09 Crystal structure of IgG1 FC M252H at pH 5.6 Deposited 2024-08-06	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252H Mutation：M252H	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；295 K；0.1M Sodium citrate pH 5.6, 20% Propanol and 20% PEG 4000	Resolution 2.92 Å R-free 0.283
9D9Q Crystal structure of IgG1 FC M252R at pH 8.0 Deposited 2024-08-21	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 238–449（212 aa） Chain B 238–449（212 aa）	Mutation：M252R Mutation：M252R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；295 K；0.1 M Tris pH 8.0 and 0.08M Sodium formate and 7.5% PEG20K	Resolution 2.82 Å R-free 0.367
9DAZ Molecular basis of pathogenicity of the recently emerged FCoV-23 coronavirus. Complex of fAPN with FCoV-23 RBD Deposited 2024-08-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 218–449（232 aa） Chain C 218–449（232 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.50 Å
9IIE Cryogenic Temperature Crystal Structure of Fc Fragment of Human IgG1 from Biosimilar VEGF-Trap Deposited 2024-06-20	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 239–446（208 aa） Fragment：Fc Fragment Chain B 239–446（208 aa） Fragment：Fc Fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；298 K；0.1M Bis-Tris pH 6.5, 25% w/v Polyethylene glycol 3350	Resolution 3.14 Å R-free 0.309
9K2Y Human IgG1 Fc fragments, mutant (2CT1.1) Deposited 2024-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 227–449（223 aa） Chain B 227–449（223 aa） Chain C 227–449（223 aa） Chain D 227–449（223 aa）	Not recorded	GAL beta-D-galactopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；50mM Sodium phosphate pH 7.0, 16% PEG 3350	Resolution 3.12 Å R-free 0.281
9K34 Human IgG1 Fc fragments, mutant (2CT1.9) Deposited 2024-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 227–449（223 aa） Chain B 227–449（223 aa） Chain C 227–449（223 aa） Chain D 227–449（223 aa）	Not recorded	FUL beta-L-fucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；50mM HEPES pH 7.0, 10% PEG 3350	Resolution 3.00 Å R-free 0.279
9KHH Structure of the complex of LGR4 with Norrin (2:2) Deposited 2024-11-10	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 220–449（230 aa） Chain F 220–449（230 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9LOC Cryo-EM structure of human FcRL5 bound to IgG-Fc Deposited 2025-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 13 PDB declaration: 13-meric	Chain B 218–443（226 aa） Chain C 218–443（226 aa） Chain D 218–443（226 aa） Chain E 218–443（226 aa） Chain F 218–443（226 aa） Chain G 218–443（226 aa） Chain H 218–443（226 aa） Chain I 218–443（226 aa） Chain J 218–443（226 aa） Chain K 218–443（226 aa） Chain L 218–443（226 aa） Chain M 218–443（226 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 13	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.56 Å
9LOD Local structure of human FcRL5 bound to IgG-Fc Deposited 2025-01-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 218–443（226 aa） Chain C 218–443（226 aa） Chain D 218–443（226 aa） Chain E 218–443（226 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
9MCX CRYSTAL STRUCTURE OF HUMAN IGG1 FC FRAGMENT-FC-GAMMA RECEPTOR IIA COMPLEX H131 VARIANT Deposited 2024-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；294 K；25% PEG 2000 MME, 0.1 M HEPES pH 7.5	Resolution 2.38 Å R-free 0.234
9MCY CRYSTAL STRUCTURE OF HUMAN IGG1 FC FRAGMENT-FC-GAMMA RECEPTOR IIA COMPLEX R131 VARIANT Deposited 2024-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；294 K；10% PEG 5000 MME, 12% isopropanol , 0.1 M MES pH 6.5	Resolution 2.85 Å R-free 0.236
9MCY CRYSTAL STRUCTURE OF HUMAN IGG1 FC FRAGMENT-FC-GAMMA RECEPTOR IIA COMPLEX R131 VARIANT Deposited 2024-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 227–449（223 aa） Chain D 227–449（223 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；294 K；10% PEG 5000 MME, 12% isopropanol , 0.1 M MES pH 6.5	Resolution 2.85 Å R-free 0.236
9OUV Crystal structure of human IGG1 FC fragment-FC-gamma receptor IIB complex Deposited 2025-05-29	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 227–449（223 aa） Chain B 227–449（223 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；150 mM sodium chloride 100 mM Tris-HCl pH 8.0 8% PEG 6000	Resolution 3.07 Å R-free 0.241
9UO5 Cryo-EM structure of the human IgG-Fc hexamer Deposited 2025-04-25	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 218–443（226 aa） Chain B 218–443（226 aa） Chain C 218–443（226 aa） Chain D 218–443（226 aa） Chain E 218–443（226 aa） Chain F 218–443（226 aa） Chain G 218–443（226 aa） Chain H 218–443（226 aa） Chain I 218–443（226 aa） Chain J 218–443（226 aa） Chain K 218–443（226 aa） Chain L 218–443（226 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.75 Å

105 other PDB entries and 128 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IGG1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 172–401； UniProt 220–449 Author chain F； PDBConstruct 172–401； UniProt 220–449

Norrin,Immunoglobulin gamma-1 heavy chain

Homo sapiens

UniProt Q00604

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain E； UniProt 25–133 Chain F； UniProt 25–133	Not recorded	MB52 × 1 Leucine-rich repeat-containing G-protein coupled receptor 4 × 1 （Q9BXB1）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.05 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9UOK	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4MY2 Crystal Structure of Norrin in fusion with Maltose Binding Protein Deposited 2013-09-27	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–104（104 aa） Fragment：Maltose binding protein (UNP residues 26-392), Norrin (UNP residues 30-133) fusion protein	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；298 K；15% PEG 3350, 0.1 M sodium acetate, pH 4.6, 0.2 M ammonium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.40 Å R-free 0.237
5BPU Crystal structure of Norrin, a Wnt signalling activator, Crystal Form I Deposited 2015-05-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 25–133（109 aa） Fragment：residues 25-133 Chain B 25–133（109 aa） Fragment：residues 25-133	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 M sodium acetate, pH 5.0, 5% PGA-LM, 30% PEG550MME	Resolution 2.40 Å R-free 0.263
5BPU Crystal structure of Norrin, a Wnt signalling activator, Crystal Form I Deposited 2015-05-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 25–133（109 aa） Fragment：residues 25-133 Chain D 25–133（109 aa） Fragment：residues 25-133	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 M sodium acetate, pH 5.0, 5% PGA-LM, 30% PEG550MME	Resolution 2.40 Å R-free 0.263
5BPU Crystal structure of Norrin, a Wnt signalling activator, Crystal Form I Deposited 2015-05-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 25–133（109 aa） Fragment：residues 25-133 Chain F 25–133（109 aa） Fragment：residues 25-133	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 M sodium acetate, pH 5.0, 5% PGA-LM, 30% PEG550MME	Resolution 2.40 Å R-free 0.263
5BQ8 Crystal structure of Norrin, a Wnt signalling activator, Crystal Form II Deposited 2015-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 25–133（109 aa） Fragment：UNP residues 25-133 Chain B 25–133（109 aa） Fragment：UNP residues 25-133	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 sodium acetate, pH 5.0, 5% PGA-LM, 4% PEG2000MME, 24% PEG550MME	Resolution 2.00 Å R-free 0.248
5BQ8 Crystal structure of Norrin, a Wnt signalling activator, Crystal Form II Deposited 2015-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 25–133（109 aa） Fragment：UNP residues 25-133 Chain D 25–133（109 aa） Fragment：UNP residues 25-133	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 sodium acetate, pH 5.0, 5% PGA-LM, 4% PEG2000MME, 24% PEG550MME	Resolution 2.00 Å R-free 0.248
5BQB Crystal structure of Norrin, a Wnt signalling activator, Crystal Form III Deposited 2015-05-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 25–133（109 aa） Fragment：residues 25-133 Chain B 25–133（109 aa） Fragment：residues 25-133	Not recorded	CIT CITRIC ACID × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1M citrate, pH 5.0, 30% PEG6000	Resolution 2.30 Å R-free 0.251
5BQB Crystal structure of Norrin, a Wnt signalling activator, Crystal Form III Deposited 2015-05-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 25–133（109 aa） Fragment：residues 25-133 Chain D 25–133（109 aa） Fragment：residues 25-133	Not recorded	CIT CITRIC ACID × 2 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1M citrate, pH 5.0, 30% PEG6000	Resolution 2.30 Å R-free 0.251
5BQC Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 and sucrose octasulfate Deposited 2015-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 25–133（109 aa） Fragment：residues 25-133	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 M Tris, pH 8.0, 0.15 M NaCl, 8% PEG8000	Resolution 3.00 Å R-free 0.268
5BQE Crystal structure of Norrin in complex with the cysteine-rich domain of Frizzled 4 -Methylated form Deposited 2015-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 25–133（109 aa） Fragment：residues 25-133 Chain B 25–133（109 aa） Fragment：residues 25-133	Non-standard monomer：Yes (specific site not provided by mmCIF)	PG0 2-(2-METHOXYETHOXY)ETHANOL × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；294 K；0.1 M Bicine, pH 9.0, 10% PEG6000	Resolution 2.30 Å R-free 0.221
5CL1 Complex structure of Norrin with human Frizzled 4 Deposited 2015-07-16	Different construct Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 31–133（103 aa） Fragment：UNP Q00604 residues 31-133 Chain B 31–133（103 aa） Fragment：UNP Q00604 residues 31-133	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；200 mM ammonium sulfate, 100 mM sodium cacodylate trihydrate (pH 6.5), 15% w/v polyethylene glycol 8,000	Resolution 3.80 Å R-free 0.310
8WVX Cryo-EM structure of LGR4 in complex with Norrin(dimer) Deposited 2023-10-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain C 31–133（103 aa） Chain D 31–133（103 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen PROPANE	Resolution 3.32 Å
8WVY Cryo-EM structure of LGR4 in complex with Norrin Deposited 2023-10-24	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 31–133（103 aa） Chain F 31–133（103 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen PROPANE	Resolution 3.29 Å
9KHH Structure of the complex of LGR4 with Norrin (2:2) Deposited 2024-11-10	Different oligomeric state Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 25–133（109 aa） Chain F 25–133（109 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.65 Å
9MAN Structure of Norrin in complex with human Tspan12 large extracellular loop (Tspan12 LEL) Deposited 2025-03-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 25–133（109 aa） Chain B 25–133（109 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.78 Å

11 other PDB entries and 15 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	NDP_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 39–147； UniProt 25–133 Author chain F； PDBConstruct 39–147； UniProt 25–133

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9uok
Deposition date deposition_date	2025-04-25
Structure title title	Structure of the complex of LGR4_ECD with Norrin
Keywords keywords	LGR4 Norrin, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	35.97 Å
Radius of gyration Rg (electron density) rg_electron	36.01 Å
Forward intensity I(0) i0	114091000.00
Molecular weight molecular_weight	83534.0 kDa
Excluded volume excluded_volume	103850 Å³
Envelope volume envelope_volume	142320 Å³
Hydration-shell volume shell_volume	35730 Å³
Envelope diameter envelope_diameter	127.1 Å
Shell Rg shell_rg	38.66 Å
Envelope Rg envelope_rg	36.07 Å
Shape Rg shape_rg	35.99 Å
Total Rg total_rg	36.26 Å
Total atoms total_atoms	5851
Residues n_residues	752
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	118.8 Å
Rg (real space) rg_real	36.10 Å
Rg uncertainty (real space) rg_real_error	1.23 Å
I(0) (real space) i0_real	1.1410e+08
I(0) uncertainty (real space) i0_real_error	2.2360e+06
Rg (reciprocal space) rg_reciprocal	36.03 Å
I(0) (reciprocal space) i0_reciprocal	114100000.0000
Solution quality estimate total_estimate	0.8824
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	40.5 Å
Skewness Skewness skewness	0.341
Kurtosis Kurtosis kurtosis	-0.505
Angular range angular_range	— – 0.2200 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9562000.0000
Real-space data points n_real_points	45
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.923; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.891; Smooth: 0.807

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	MB52
Molecular weight formula_weight	59266.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	5851

MKKIWLALAGLVLAFSASAQVQLVESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTNNANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNLNSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMTMQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNPFRASGGGSGGGGSGKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAYQATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNGTHSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSKYGSLRLSCAASGYTYSPYCMGWFRQAPGKAREGVATVDLDGSTIYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCASRTRAGVTCGLNWAIFSYWGQGTQVTVSSHHHHHH

来源 Source

来源生物 organism	Camelus ferus
NCBI Class编号 ncbi_taxonomy_id	419612
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Leucine-rich repeat-containing G-protein coupled receptor 4
Molecular weight formula_weight	105397.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MKTIIALSYIFCLVFAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLKQFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLLMAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQDFYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKDAAADYKDDDDK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Norrin,Immunoglobulin gamma-1 heavy chain
Molecular weight formula_weight	45313.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAKTDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNSGGSGGSGGLEVLFQGPGGSGGSGGKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKATPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDYKDDDDK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.050 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.05 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	1196610

fit	/app/data/saxs_computation/uo/9uok/9uok.fit
pddf	/app/data/pr_computation/uo/9uok/9uok.pr.out
profile	/app/data/saxs_computation/uo/9uok/9uok.dat

Structure of the complex of LGR4_ECD with Norrin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Leucine-rich repeat-containing G-protein coupled receptor 4

State in the Current Structure

Other States of the Same Protein in the Database

Norrin,Immunoglobulin gamma-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

Norrin,Immunoglobulin gamma-1 heavy chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)