7nyz

Cryo-EM structure of the MukBEF-MatP-DNA monomer (partially open conformation)

Method: ELECTRON MICROSCOPY D_max: 260.6 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromosome partition protein MukB

Photorhabdus thracensis

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 10 DNA 4 PDB declaration: tetradecameric（14） Consistent with all polymer counts	Chain A； UniProt 1–1482 Chain B； UniProt 1–1482	Mutation：E1407Q	Chromosome partition protein MukF × 2 （A0A0F7LMQ4） Chromosome partition protein MukE × 2 （A0A0F7LPV6） Acyl carrier protein × 2 （A0A6D2XA84） Macrodomain Ter protein × 2 （A0A0F7LUV5） matS2 DNA 80 b, oligo FBA769 × 1 matS2 DNA 80 b, oligo FBA770 × 1 DNA 80 b × 2 MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.50 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NYZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain A1 1–1482（1482 aa） Chain A2 1–1482（1482 aa） Chain A3 1–1482（1482 aa） Chain A4 1–1482（1482 aa） Chain B1 1–1482（1482 aa） Chain B2 1–1482（1482 aa） Chain B3 1–1482（1482 aa） Chain B4 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain A1 1–1482（1482 aa） Chain A2 1–1482（1482 aa） Chain B1 1–1482（1482 aa） Chain B2 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ4 Cryo-EM structure of the MukBEF dimer Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A1 1–1482（1482 aa） Chain A2 1–1482（1482 aa） Chain B1 1–1482（1482 aa） Chain B2 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q	PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 13.00 Å
9GM6 MukBEF in a nucleotide-bound state with open neck gate (heads core) Deposited 2024-08-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å
9GM7 MukBEF in a nucleotide-bound state with open neck gate (monomer) Deposited 2024-08-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.30 Å
9GM8 MukBEF in a nucleotide-bound state with open neck gate Deposited 2024-08-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
9GM9 MukBEF in a DNA capture state Deposited 2024-08-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 7.80 Å
9GMA MukBEF in a DNA capture state (dimer) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa） Chain O 1–1482（1482 aa） Chain P 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 9.10 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7LRY2_9GAMM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1482； UniProt 1–1482 Author chain B； PDBConstruct 1–1482； UniProt 1–1482

Chromosome partition protein MukF

Photorhabdus thracensis

UniProt A0A0F7LMQ4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 10 DNA 4 PDB declaration: tetradecameric（14） Consistent with all polymer counts	Chain C； UniProt 1–440 Chain D； UniProt 1–440	Not recorded	Chromosome partition protein MukB × 2 （A0A0F7LRY2） Chromosome partition protein MukE × 2 （A0A0F7LPV6） Acyl carrier protein × 2 （A0A6D2XA84） Macrodomain Ter protein × 2 （A0A0F7LUV5） matS2 DNA 80 b, oligo FBA769 × 1 matS2 DNA 80 b, oligo FBA770 × 1 DNA 80 b × 2 MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7NYZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain C1 1–440（440 aa） Chain C2 1–440（440 aa） Chain D1 1–440（440 aa） Chain D2 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain C1 1–440（440 aa） Chain C2 1–440（440 aa） Chain D1 1–440（440 aa） Chain D2 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ4 Cryo-EM structure of the MukBEF dimer Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain C1 1–440（440 aa） Chain D1 1–440（440 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 13.00 Å
9GM6 MukBEF in a nucleotide-bound state with open neck gate (heads core) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å
9GM7 MukBEF in a nucleotide-bound state with open neck gate (monomer) Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.30 Å
9GM8 MukBEF in a nucleotide-bound state with open neck gate Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
9GM9 MukBEF in a DNA capture state Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 7.80 Å
9GMA MukBEF in a DNA capture state (dimer) Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 9.10 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7LMQ4_9GAMM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–440； UniProt 1–440 Author chain D； PDBConstruct 1–440； UniProt 1–440

Chromosome partition protein MukE

Photorhabdus thracensis

UniProt A0A0F7LPV6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 10 DNA 4 PDB declaration: tetradecameric（14） Consistent with all polymer counts	Chain E； UniProt 1–240 Chain F； UniProt 1–240	Not recorded	Chromosome partition protein MukB × 2 （A0A0F7LRY2） Chromosome partition protein MukF × 2 （A0A0F7LMQ4） Acyl carrier protein × 2 （A0A6D2XA84） Macrodomain Ter protein × 2 （A0A0F7LUV5） matS2 DNA 80 b, oligo FBA769 × 1 matS2 DNA 80 b, oligo FBA770 × 1 DNA 80 b × 2 MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7NYZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain E1 1–240（240 aa） Chain E2 1–240（240 aa） Chain E3 1–240（240 aa） Chain E4 1–240（240 aa） Chain F1 1–240（240 aa） Chain F2 1–240（240 aa） Chain F3 1–240（240 aa） Chain F4 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain E1 1–240（240 aa） Chain E2 1–240（240 aa） Chain F1 1–240（240 aa） Chain F2 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ4 Cryo-EM structure of the MukBEF dimer Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain E1 1–240（240 aa） Chain E2 1–240（240 aa） Chain F1 1–240（240 aa） Chain F2 1–240（240 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 13.00 Å
9GM6 MukBEF in a nucleotide-bound state with open neck gate (heads core) Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å
9GM7 MukBEF in a nucleotide-bound state with open neck gate (monomer) Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.30 Å
9GM8 MukBEF in a nucleotide-bound state with open neck gate Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
9GM9 MukBEF in a DNA capture state Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain E 1–240（240 aa） Chain F 1–240（240 aa） Chain Q 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 7.80 Å
9GMA MukBEF in a DNA capture state (dimer) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa） Chain Q 1–240（240 aa） Chain R 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 9.10 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7LPV6_9GAMM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–240； UniProt 1–240 Author chain F； PDBConstruct 1–240； UniProt 1–240

Acyl carrier protein

OrganismNot specified

UniProt A0A6D2XA84

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 10 DNA 4 PDB declaration: tetradecameric（14） Consistent with all polymer counts	Chain G； UniProt 1–78 Chain H； UniProt 1–78	Not recorded	Chromosome partition protein MukB × 2 （A0A0F7LRY2） Chromosome partition protein MukF × 2 （A0A0F7LMQ4） Chromosome partition protein MukE × 2 （A0A0F7LPV6） Macrodomain Ter protein × 2 （A0A0F7LUV5） matS2 DNA 80 b, oligo FBA769 × 1 matS2 DNA 80 b, oligo FBA770 × 1 DNA 80 b × 2 MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7NYZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain G1 1–78（78 aa） Chain G2 1–78（78 aa） Chain G3 1–78（78 aa） Chain G4 1–78（78 aa） Chain H1 1–78（78 aa） Chain H2 1–78（78 aa） Chain H3 1–78（78 aa） Chain H4 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain G1 1–78（78 aa） Chain G2 1–78（78 aa） Chain H1 1–78（78 aa） Chain H2 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ4 Cryo-EM structure of the MukBEF dimer Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain G1 1–78（78 aa） Chain G2 1–78（78 aa） Chain H1 1–78（78 aa） Chain H2 1–78（78 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 13.00 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A6D2XA84_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–78； UniProt 1–78 Author chain H； PDBConstruct 1–78； UniProt 1–78

Macrodomain Ter protein

Photorhabdus thracensis

UniProt A0A0F7LUV5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Heteromer Protein × 10 DNA 4 PDB declaration: tetradecameric（14） Consistent with all polymer counts	Chain I； UniProt 1–151 Chain J； UniProt 1–151	Not recorded	Chromosome partition protein MukB × 2 （A0A0F7LRY2） Chromosome partition protein MukF × 2 （A0A0F7LMQ4） Chromosome partition protein MukE × 2 （A0A0F7LPV6） Acyl carrier protein × 2 （A0A6D2XA84） matS2 DNA 80 b, oligo FBA769 × 1 matS2 DNA 80 b, oligo FBA770 × 1 DNA 80 b × 2 MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 6.50 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 7NYZ	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain I 1–151（151 aa） Chain J 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain I 1–151（151 aa） Chain J 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain I 1–151（151 aa） Chain J 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain I1 1–151（151 aa） Chain I2 1–151（151 aa） Chain I3 1–151（151 aa） Chain I4 1–151（151 aa） Chain J1 1–151（151 aa） Chain J2 1–151（151 aa） Chain J3 1–151（151 aa） Chain J4 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain I1 1–151（151 aa） Chain I2 1–151（151 aa） Chain J1 1–151（151 aa） Chain J2 1–151（151 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7LUV5_9GAMM
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain I； PDBConstruct 1–151； UniProt 1–151 Author chain J； PDBConstruct 1–151； UniProt 1–151

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nyz
Deposition date deposition_date	2021-03-23
Structure title title	Cryo-EM structure of the MukBEF-MatP-DNA monomer (partially open conformation)
Keywords keywords	SMC-kleisin complex, ATPase, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	88.45 Å
Radius of gyration Rg (electron density) rg_electron	91.79 Å
Forward intensity I(0) i0	4320890000.00
Molecular weight molecular_weight	515270.0 kDa
Excluded volume excluded_volume	628960 Å³
Envelope volume envelope_volume	1141600 Å³
Hydration-shell volume shell_volume	123140 Å³
Envelope diameter envelope_diameter	337.8 Å
Shell Rg shell_rg	66.28 Å
Envelope Rg envelope_rg	91.07 Å
Shape Rg shape_rg	91.91 Å
Total Rg total_rg	91.04 Å
Total atoms total_atoms	70851
Residues n_residues	4290
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	260.6 Å
Rg (real space) rg_real	83.08 Å
Rg uncertainty (real space) rg_real_error	1.83 Å
I(0) (real space) i0_real	4.1690e+09
I(0) uncertainty (real space) i0_real_error	9.8010e+07
Rg (reciprocal space) rg_reciprocal	80.42 Å
I(0) (reciprocal space) i0_reciprocal	4222000000.0000
Solution quality estimate total_estimate	0.8866
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	72.4 Å
Skewness Skewness skewness	0.661
Kurtosis Kurtosis kurtosis	-0.276
Angular range angular_range	— – 0.0900 Å⁻¹
Current regularization parameter α current_alpha	0.3793
Highest regularization parameter α highest_alpha	135700000.0000
Real-space data points n_real_points	19
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.001; Oscil: 0.793; Stabil: 0.973; Sysdev: 1.000; Positv: 1.000; Valcen: 0.994; Smooth: 0.235

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Chromosome partition protein MukB
Molecular weight formula_weight	170240.2 kDa
Mutation mutation	E1407Q
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	70851

MIERGKFRSLTLVNWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLRAGVCYSTLDVINSRHQRVVVGVRLQQVAGRDRKVDIKPFMIQGLPTAIQPTQLLTENVGERQARVLPLNELKDRLDEMEGVQFKQFNSITDYHAQMFDLGVIPKRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSGVRKAFQDMEAALRENRITLEAIRVTQSDRDLFKHLITEATSYVSADYMRHANERRTHLDEALALRGELFGSHKQLATEQYRHVEMARELAEQSGASSDLETDHQAASDHLNLVQTAMRQQEKIDRYQVDLEELSYRLEEQTDVVEEAGELQAEYEARTEATEQEVDELKSQLADYQQALDVQQTRAIQYQQALQALERARELCRLPDLSVDNAEEWLETFQAKEQQATEALLALEQKLSVADAAHNQFEQAYQLVKNIVGETSRSEAWQSARELLRDWPSQRHLADRVQPLRMRLSELEQRLNNQQNAERLLSEFCKRQGRQYQAEDLEALQNELEARQEALSLSVNEGGERRMEMRQELEQLKQKIQSLTARAPVWLAAQDTLNQLCEQSGETLASSNDVTEYMQQLLEREREATVERDEVAAQKRELEKQIERLSQPSGAEDSRMIALAERFGGVLLSEIYDDITIDDAPYFSALYGPARHGIVVPDLSLVRPHLETLEDCPEDLYLIEGDPQSFDDSVFNAEEQTNAVLVKSSDRQWRYSRYPELPLFGRAARENRLEALNLERDALAERYATLSFDVQKIQRAHQAFSQFVGKHLSVAFDTDPEAEIRELRQRHTELEREVSRFEDQTQQQRQQYAQAKESLTTLNRLIPQVTLLLDETLIDRVEEVREEMDEAQEAARFLQQHGSALTKLEPMVAVLQSDPQQHEQLQQDYETAKHSQHQAKQQAFALVEIVQRRVHFSYSDSAGMLSENADLNDKLRQRLEHAESDRSRAREQLRQQQAQYSQFNQVLASLKSSYETKQDMLKELLQEMKDIGVQADANAEMRARERRDRLHEALSVNRSRVNQLEKQIAFCEAEMENVQKKLRKLERDYYQIREQVVSAKAGWCAVMRMVKDNGVERRLHRRELAYMEGGALRSMSDKALGALRLAVADNEHLRDALRLSEDPKRPERKVQFFIAVYQHLRERIRQDIIRTDDPVDAIEQMEIELARLTEELTAREQKLAISSKSVANIIRKTIQREQNRIRMLNQGLQAVSFGQVRGVRLNVNVRESHAILLDVLSEQQEQHQDLFNSQRLTFSEAMAKLYQRLNPQVDMGQRLPQTIGEELLDYRNYLELDVEVNRGSDGWLKAESGALSTGEAIGTGMSILVMVVQSWEEESRRLRGKDISPCRLLFLDQAARLDAKSIATLFELCERLQMQLIIAAPENISPEKGTTYKLVRKVFKNHEHVHVVGLRGFGQDAPATQLISDVTA

来源 Source

来源生物 organism	Photorhabdus thracensis
NCBI Class编号 ncbi_taxonomy_id	230089
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Chromosome partition protein MukF
Molecular weight formula_weight	50193.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MSEYSQTVPELVSWARKNDFSISLPVERLAFLMAIAVLNSERLDGEMSEGELIDAFREVCKGFEQTAESVAVRANNAINDMVRQKLLNRFTSELADGNAIYRLTPLGISISDYYIRQREFSTLRLSMQLSIVANELHRAAEAAEEGGDEFHWHRNVFAPLKYSVAEIFDSIDMSQRLMDEQQNFVKEDIAALLNQDWQAAIANCEQLLSETSGTLRELQDTLEAAGDKLQANLLRIQDANMGSGGSELVDKLVFDLQSKLDRIISWGQQAIDLWIGYDRHVHKFIRTAIDMDKNRIFSQRLRQSVQHYFDNPWTLTVANAERLLDMRDEELALRNEEVTGELPLELEYEEFSEINDQLAAMIEKALLVYQQEQRPLDLGAVLRDYLAQHPLPRHFDVARILVDQAVRLGVAEADFSGLPAEWLAINDYGAKVQAHVIDTY

来源 Source

来源生物 organism	Photorhabdus thracensis
NCBI Class编号 ncbi_taxonomy_id	230089
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Chromosome partition protein MukE
Molecular weight formula_weight	27423.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F

MSSTHIEQFMPVKLAQALANSLFPELDSQLRAGRHIGIDDLDNHAFLMDFQEQLEEFYARYNVELIRAPEGFFYLRPRSTTLIPRSVLSELDMMVGKILCYLYLSPERLANQGIFTSQELYEELISLADEGKLMKFVNQRSSGSDLDKQKLQEKVRTTLNRLRRLGMVYFLPNNNNKFTITEAVFRFGADVRSGDDPREIQLRMIRDGEAMPVEGSLSLDDSENDETPDNSAEGAGDEQP

来源 Source

来源生物 organism	Photorhabdus thracensis
NCBI Class编号 ncbi_taxonomy_id	230089
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Acyl carrier protein
Molecular weight formula_weight	8645.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H

MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA

Entity 5 Entity 5 polymer

Description description	Macrodomain Ter protein
Molecular weight formula_weight	18032.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

MKYQQLENLECGWKWAYLIRKHQEGEPITKYIENSAAHAAVDKLIKLESEPVRVLEWIEQHMNPDLFNRMKQTIRARRKRHFNAEHQHTRKKSIDLDFPVWHRLSALSQRRGNTLSETIVQLIEDAERKEKYANQMSSLKHDLEAILGKNE

来源 Source

来源生物 organism	Photorhabdus thracensis
NCBI Class编号 ncbi_taxonomy_id	230089
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 6 Entity 6 polymer

Description description	matS2 DNA 80 b, oligo FBA769
Molecular weight formula_weight	24625.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	K

CTCGCCTGTAAAGTAGGCATTAGTTGTTCGTAGTGCTCGTCTGGCTCTGGATTACCCGCCACTGTTACATTGTAACGGCA

Entity 7 Entity 7 polymer

Description description	matS2 DNA 80 b, oligo FBA770
Molecular weight formula_weight	24715.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	L

TGCCGTTACAATGTAACAGTGGCGGGTAATCCAGAGCCAGACGAGCACTACGAACAACTAATGCCTACTTTACAGGCGAG

Entity 8 Entity 8 polymer

Description description	DNA 80 b
Molecular weight formula_weight	9216.0 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	M,N

ATATATATATATATATATATATATATATAT

Entity 9 Entity 9 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	4'-PHOSPHOPANTETHEINE
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (2)

▶

Resolution resolution	6.50 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	41109

fit	/app/data/saxs_computation/ny/7nyz/7nyz.fit
pddf	/app/data/pr_computation/ny/7nyz/7nyz.pr.out
profile	/app/data/saxs_computation/ny/7nyz/7nyz.dat

Cryo-EM structure of the MukBEF-MatP-DNA monomer (partially open conformation)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromosome partition protein MukB

State in the Current Structure

Other States of the Same Protein in the Database

Chromosome partition protein MukF

State in the Current Structure

Other States of the Same Protein in the Database

Chromosome partition protein MukE

State in the Current Structure

Other States of the Same Protein in the Database

Acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

Macrodomain Ter protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

来源 Source

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)