SAXSdb — 7nz4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromosome partition protein MukB

Photorhabdus thracensis

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain A1； UniProt 1–1482 Chain A2； UniProt 1–1482 Chain B1； UniProt 1–1482 Chain B2； UniProt 1–1482	Mutation：E1407Q	Chromosome partition protein MukF × 2 （A0A0F7LMQ4） Chromosome partition protein MukE × 4 （A0A0F7LPV6） Acyl carrier protein × 4 （A0A6D2XA84） PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 13.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NZ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NYZ Cryo-EM structure of the MukBEF-MatP-DNA monomer (partially open conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.50 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain A1 1–1482（1482 aa） Chain A2 1–1482（1482 aa） Chain A3 1–1482（1482 aa） Chain A4 1–1482（1482 aa） Chain B1 1–1482（1482 aa） Chain B2 1–1482（1482 aa） Chain B3 1–1482（1482 aa） Chain B4 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain A1 1–1482（1482 aa） Chain A2 1–1482（1482 aa） Chain B1 1–1482（1482 aa） Chain B2 1–1482（1482 aa）	Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q Mutation：E1407Q	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
9GM6 MukBEF in a nucleotide-bound state with open neck gate (heads core) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å
9GM7 MukBEF in a nucleotide-bound state with open neck gate (monomer) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.30 Å
9GM8 MukBEF in a nucleotide-bound state with open neck gate Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
9GM9 MukBEF in a DNA capture state Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 7.80 Å
9GMA MukBEF in a DNA capture state (dimer) Deposited 2024-08-28	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain A 1–1482（1482 aa） Chain B 1–1482（1482 aa） Chain O 1–1482（1482 aa） Chain P 1–1482（1482 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 9.10 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7LRY2_9GAMM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A1； PDBConstruct 1–1482； UniProt 1–1482 Author chain A2； PDBConstruct 1–1482； UniProt 1–1482 Author chain B1； PDBConstruct 1–1482； UniProt 1–1482 Author chain B2； PDBConstruct 1–1482； UniProt 1–1482

Chromosome partition protein MukF

Photorhabdus thracensis

UniProt A0A0F7LMQ4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain C1； UniProt 1–440 Chain D1； UniProt 1–440	Not recorded	Chromosome partition protein MukB × 4 （A0A0F7LRY2） Chromosome partition protein MukE × 4 （A0A0F7LPV6） Acyl carrier protein × 4 （A0A6D2XA84） PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 13.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NZ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NYZ Cryo-EM structure of the MukBEF-MatP-DNA monomer (partially open conformation) Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.50 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain C1 1–440（440 aa） Chain C2 1–440（440 aa） Chain D1 1–440（440 aa） Chain D2 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain C1 1–440（440 aa） Chain C2 1–440（440 aa） Chain D1 1–440（440 aa） Chain D2 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
9GM6 MukBEF in a nucleotide-bound state with open neck gate (heads core) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain C 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å
9GM7 MukBEF in a nucleotide-bound state with open neck gate (monomer) Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.30 Å
9GM8 MukBEF in a nucleotide-bound state with open neck gate Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
9GM9 MukBEF in a DNA capture state Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 7.80 Å
9GMA MukBEF in a DNA capture state (dimer) Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain C 1–440（440 aa） Chain D 1–440（440 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 9.10 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7LMQ4_9GAMM
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C1； PDBConstruct 1–440； UniProt 1–440 Author chain D1； PDBConstruct 1–440； UniProt 1–440

Chromosome partition protein MukE

Photorhabdus thracensis

UniProt A0A0F7LPV6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain E1； UniProt 1–240 Chain E2； UniProt 1–240 Chain F1； UniProt 1–240 Chain F2； UniProt 1–240	Not recorded	Chromosome partition protein MukB × 4 （A0A0F7LRY2） Chromosome partition protein MukF × 2 （A0A0F7LMQ4） Acyl carrier protein × 4 （A0A6D2XA84） PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 13.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NZ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NYZ Cryo-EM structure of the MukBEF-MatP-DNA monomer (partially open conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.50 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain E1 1–240（240 aa） Chain E2 1–240（240 aa） Chain E3 1–240（240 aa） Chain E4 1–240（240 aa） Chain F1 1–240（240 aa） Chain F2 1–240（240 aa） Chain F3 1–240（240 aa） Chain F4 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain E1 1–240（240 aa） Chain E2 1–240（240 aa） Chain F1 1–240（240 aa） Chain F2 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
9GM6 MukBEF in a nucleotide-bound state with open neck gate (heads core) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.70 Å
9GM7 MukBEF in a nucleotide-bound state with open neck gate (monomer) Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 4.30 Å
9GM8 MukBEF in a nucleotide-bound state with open neck gate Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 3.90 Å
9GM9 MukBEF in a DNA capture state Deposited 2024-08-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 9 PDB declaration: 11-meric	Chain E 1–240（240 aa） Chain F 1–240（240 aa） Chain Q 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 7.80 Å
9GMA MukBEF in a DNA capture state (dimer) Deposited 2024-08-28	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 14 PDB declaration: hexadecameric	Chain E 1–240（240 aa） Chain F 1–240（240 aa） Chain Q 1–240（240 aa） Chain R 1–240（240 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 9.10 Å

12 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A0F7LPV6_9GAMM
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E1； PDBConstruct 1–240； UniProt 1–240 Author chain E2； PDBConstruct 1–240； UniProt 1–240 Author chain F1； PDBConstruct 1–240； UniProt 1–240 Author chain F2； PDBConstruct 1–240； UniProt 1–240

Acyl carrier protein

OrganismNot specified

UniProt A0A6D2XA84

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain G1； UniProt 1–78 Chain G2； UniProt 1–78 Chain H1； UniProt 1–78 Chain H2； UniProt 1–78	Not recorded	Chromosome partition protein MukB × 4 （A0A0F7LRY2） Chromosome partition protein MukF × 2 （A0A0F7LMQ4） Chromosome partition protein MukE × 4 （A0A0F7LPV6） PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.3 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 13.00 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7NZ4	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7NYW Cryo-EM structure of the MukBEF-MatP-DNA head module Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
7NYX Cryo-EM structure of the MukBEF-MatP-DNA monomer (closed conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.60 Å
7NYY Cryo-EM structure of the MukBEF monomer Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.80 Å
7NYZ Cryo-EM structure of the MukBEF-MatP-DNA monomer (partially open conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.50 Å
7NZ0 Cryo-EM structure of the MukBEF-MatP-DNA monomer (open conformation) Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 10 PDB declaration: tetradecameric	Chain G 1–78（78 aa） Chain H 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 2 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 PNS 4'-PHOSPHOPANTETHEINE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.30 Å
7NZ2 Cryo-EM structure of the MukBEF-MatP-DNA tetrad Deposited 2021-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 36 PDB declaration: 44-meric	Chain G1 1–78（78 aa） Chain G2 1–78（78 aa） Chain G3 1–78（78 aa） Chain G4 1–78（78 aa） Chain H1 1–78（78 aa） Chain H2 1–78（78 aa） Chain H3 1–78（78 aa） Chain H4 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 8 ATP ADENOSINE-5'-TRIPHOSPHATE × 8 PNS 4'-PHOSPHOPANTETHEINE × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å
7NZ3 Cryo-EM structure of apposed MukBEF-MatP monomers on DNA Deposited 2021-03-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein–DNA Heteromer；Protein × 20 PDB declaration: 24-meric	Chain G1 1–78（78 aa） Chain G2 1–78（78 aa） Chain H1 1–78（78 aa） Chain H2 1–78（78 aa）	Not recorded	MG MAGNESIUM ION × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 PNS 4'-PHOSPHOPANTETHEINE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 11.00 Å

7 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	A0A6D2XA84_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G1； PDBConstruct 1–78； UniProt 1–78 Author chain G2； PDBConstruct 1–78； UniProt 1–78 Author chain H1； PDBConstruct 1–78； UniProt 1–78 Author chain H2； PDBConstruct 1–78； UniProt 1–78

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7nz4
Deposition date deposition_date	2021-03-23
Structure title title	Cryo-EM structure of the MukBEF dimer
Keywords keywords	SMC-kleisin complex, ATPase, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	133.10 Å
Forward intensity I(0) i0	11974100000.00
Molecular weight molecular_weight	898570.0 kDa
Excluded volume excluded_volume	1111900 Å³
Envelope volume envelope_volume	2384300 Å³
Hydration-shell volume shell_volume	178540 Å³
Envelope diameter envelope_diameter	557.8 Å
Shell Rg shell_rg	88.37 Å
Envelope Rg envelope_rg	133.40 Å
Shape Rg shape_rg	133.10 Å
Total Rg total_rg	132.50 Å
Total atoms total_atoms	125656
Residues n_residues	7824
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	331.2 Å
Rg (real space) rg_real	118.70 Å
Rg uncertainty (real space) rg_real_error	1.59 Å
I(0) (real space) i0_real	1.1300e+10
I(0) uncertainty (real space) i0_real_error	2.9370e+08
Rg (reciprocal space) rg_reciprocal	108.60 Å
I(0) (reciprocal space) i0_reciprocal	11110000000.0000
Solution quality estimate total_estimate	0.9160
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	82.8 Å
Skewness Skewness skewness	0.222
Kurtosis Kurtosis kurtosis	-0.936
Angular range angular_range	— – 0.0600 Å⁻¹
Current regularization parameter α current_alpha	0.7609
Highest regularization parameter α highest_alpha	270500000.0000
Real-space data points n_real_points	13
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.092; Oscil: 0.998; Stabil: 0.985; Sysdev: 1.000; Positv: 1.000; Valcen: 0.967; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Chromosome partition protein MukB
Molecular weight formula_weight	170240.2 kDa
Mutation mutation	E1407Q
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A1,A2,B1,B2
Atom count atom_count	125656

MIERGKFRSLTLVNWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLRAGVCYSTLDVINSRHQRVVVGVRLQQVAGRDRKVDIKPFMIQGLPTAIQPTQLLTENVGERQARVLPLNELKDRLDEMEGVQFKQFNSITDYHAQMFDLGVIPKRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSGVRKAFQDMEAALRENRITLEAIRVTQSDRDLFKHLITEATSYVSADYMRHANERRTHLDEALALRGELFGSHKQLATEQYRHVEMARELAEQSGASSDLETDHQAASDHLNLVQTAMRQQEKIDRYQVDLEELSYRLEEQTDVVEEAGELQAEYEARTEATEQEVDELKSQLADYQQALDVQQTRAIQYQQALQALERARELCRLPDLSVDNAEEWLETFQAKEQQATEALLALEQKLSVADAAHNQFEQAYQLVKNIVGETSRSEAWQSARELLRDWPSQRHLADRVQPLRMRLSELEQRLNNQQNAERLLSEFCKRQGRQYQAEDLEALQNELEARQEALSLSVNEGGERRMEMRQELEQLKQKIQSLTARAPVWLAAQDTLNQLCEQSGETLASSNDVTEYMQQLLEREREATVERDEVAAQKRELEKQIERLSQPSGAEDSRMIALAERFGGVLLSEIYDDITIDDAPYFSALYGPARHGIVVPDLSLVRPHLETLEDCPEDLYLIEGDPQSFDDSVFNAEEQTNAVLVKSSDRQWRYSRYPELPLFGRAARENRLEALNLERDALAERYATLSFDVQKIQRAHQAFSQFVGKHLSVAFDTDPEAEIRELRQRHTELEREVSRFEDQTQQQRQQYAQAKESLTTLNRLIPQVTLLLDETLIDRVEEVREEMDEAQEAARFLQQHGSALTKLEPMVAVLQSDPQQHEQLQQDYETAKHSQHQAKQQAFALVEIVQRRVHFSYSDSAGMLSENADLNDKLRQRLEHAESDRSRAREQLRQQQAQYSQFNQVLASLKSSYETKQDMLKELLQEMKDIGVQADANAEMRARERRDRLHEALSVNRSRVNQLEKQIAFCEAEMENVQKKLRKLERDYYQIREQVVSAKAGWCAVMRMVKDNGVERRLHRRELAYMEGGALRSMSDKALGALRLAVADNEHLRDALRLSEDPKRPERKVQFFIAVYQHLRERIRQDIIRTDDPVDAIEQMEIELARLTEELTAREQKLAISSKSVANIIRKTIQREQNRIRMLNQGLQAVSFGQVRGVRLNVNVRESHAILLDVLSEQQEQHQDLFNSQRLTFSEAMAKLYQRLNPQVDMGQRLPQTIGEELLDYRNYLELDVEVNRGSDGWLKAESGALSTGEAIGTGMSILVMVVQSWEEESRRLRGKDISPCRLLFLDQAARLDAKSIATLFELCERLQMQLIIAAPENISPEKGTTYKLVRKVFKNHEHVHVVGLRGFGQDAPATQLISDVTA

来源 Source

来源生物 organism	Photorhabdus thracensis
NCBI Class编号 ncbi_taxonomy_id	230089
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Chromosome partition protein MukF
Molecular weight formula_weight	50193.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C1,D1

MSEYSQTVPELVSWARKNDFSISLPVERLAFLMAIAVLNSERLDGEMSEGELIDAFREVCKGFEQTAESVAVRANNAINDMVRQKLLNRFTSELADGNAIYRLTPLGISISDYYIRQREFSTLRLSMQLSIVANELHRAAEAAEEGGDEFHWHRNVFAPLKYSVAEIFDSIDMSQRLMDEQQNFVKEDIAALLNQDWQAAIANCEQLLSETSGTLRELQDTLEAAGDKLQANLLRIQDANMGSGGSELVDKLVFDLQSKLDRIISWGQQAIDLWIGYDRHVHKFIRTAIDMDKNRIFSQRLRQSVQHYFDNPWTLTVANAERLLDMRDEELALRNEEVTGELPLELEYEEFSEINDQLAAMIEKALLVYQQEQRPLDLGAVLRDYLAQHPLPRHFDVARILVDQAVRLGVAEADFSGLPAEWLAINDYGAKVQAHVIDTY

来源 Source

来源生物 organism	Photorhabdus thracensis
NCBI Class编号 ncbi_taxonomy_id	230089
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Chromosome partition protein MukE
Molecular weight formula_weight	27423.8 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E1,E2,F1,F2

MSSTHIEQFMPVKLAQALANSLFPELDSQLRAGRHIGIDDLDNHAFLMDFQEQLEEFYARYNVELIRAPEGFFYLRPRSTTLIPRSVLSELDMMVGKILCYLYLSPERLANQGIFTSQELYEELISLADEGKLMKFVNQRSSGSDLDKQKLQEKVRTTLNRLRRLGMVYFLPNNNNKFTITEAVFRFGADVRSGDDPREIQLRMIRDGEAMPVEGSLSLDDSENDETPDNSAEGAGDEQP

来源 Source

来源生物 organism	Photorhabdus thracensis
NCBI Class编号 ncbi_taxonomy_id	230089
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 polymer

Description description	Acyl carrier protein
Molecular weight formula_weight	8645.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G1,G2,H1,H2

MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAIDYINGHQA

Entity 5 Entity 5 non-polymer

Description description	4'-PHOSPHOPANTETHEINE
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	4

▶

8. Citations (2)

▶

Resolution resolution	13.00 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	4197

fit	/app/data/saxs_computation/nz/7nz4/7nz4.fit
pddf	/app/data/pr_computation/nz/7nz4/7nz4.pr.out
profile	/app/data/saxs_computation/nz/7nz4/7nz4.dat

Cryo-EM structure of the MukBEF dimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Chromosome partition protein MukB

State in the Current Structure

Other States of the Same Protein in the Database

Chromosome partition protein MukF

State in the Current Structure

Other States of the Same Protein in the Database

Chromosome partition protein MukE

State in the Current Structure

Other States of the Same Protein in the Database

Acyl carrier protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 non-polymer

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)