7oy8

Cryo-EM structure of the Rhodospirillum rubrum RC-LH1 complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light-harvesting protein B-870 beta chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Antenna complex, alpha/beta subunit × 15 （Q2RQ24） Photosynthetic reaction center, H-chain × 1 （Q2RWS4） Photosynthetic reaction center L subunit × 1 （Q2RQ25） Reaction center protein M chain × 1 （Q2RQ26） Antenna complex, alpha/beta subunit × 1 （Q2RQ24） Trans-Geranyl BACTERIOCHLOROPHYLL A × 37 SPIRILLOXANTHIN × 17 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 ;(2R,5R,11R,14R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-2,14-bis(tetradecanoyloxy)-4,6,10,12,16-pentaoxa-5,11-diphosphatriacont-1-yl tetradecanoate ; × 2 BACTERIOPHEOPHYTIN A × 2 ;2-azanyl-5-[(2~{E},6~{E},8~{E},10~{E},12~{E},14~{E},18~{E},22~{E},26~{E},30~{E},34~{E})-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,8,10,12,14,18,22,26,30,34,38-dodecaenyl]-3-methoxy-6-methyl-cyclohexa-2,5-diene-1,4-dione ; × 1 UBIQUINONE-10 × 3 FE (III) ION × 1 CHLORIDE ION × 1 PHOSPHATE ION × 1 DODECYL-BETA-D-MALTOSIDE × 1 water × 33	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LHB_RHORT
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–54； UniProt 3–56 Author chain 3； PDBConstruct 1–54； UniProt 3–56 Author chain 5； PDBConstruct 1–54； UniProt 3–56 Author chain 7； PDBConstruct 1–54； UniProt 3–56 Author chain 9； PDBConstruct 1–54； UniProt 3–56 Author chain I； PDBConstruct 1–54； UniProt 3–56 Author chain K； PDBConstruct 1–54； UniProt 3–56 Author chain O； PDBConstruct 1–54； UniProt 3–56 Author chain Q； PDBConstruct 1–54； UniProt 3–56 Author chain S； PDBConstruct 1–54； UniProt 3–56 Author chain U； PDBConstruct 1–54； UniProt 3–56 Author chain W； PDBConstruct 1–54； UniProt 3–56 Author chain Y； PDBConstruct 1–54； UniProt 3–56 Author chain d； PDBConstruct 1–54； UniProt 3–56 Author chain m； PDBConstruct 1–54； UniProt 3–56 Author chain n； PDBConstruct 1–54； UniProt 3–56

Antenna complex, alpha/beta subunit

OrganismNot specified

UniProt Q2RQ24

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Light-harvesting protein B-870 beta chain × 16 （Q2RQ23） Photosynthetic reaction center, H-chain × 1 （Q2RWS4） Photosynthetic reaction center L subunit × 1 （Q2RQ25） Reaction center protein M chain × 1 （Q2RQ26） Trans-Geranyl BACTERIOCHLOROPHYLL A × 37 SPIRILLOXANTHIN × 17 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 ;(2R,5R,11R,14R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-2,14-bis(tetradecanoyloxy)-4,6,10,12,16-pentaoxa-5,11-diphosphatriacont-1-yl tetradecanoate ; × 2 BACTERIOPHEOPHYTIN A × 2 ;2-azanyl-5-[(2~{E},6~{E},8~{E},10~{E},12~{E},14~{E},18~{E},22~{E},26~{E},30~{E},34~{E})-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,8,10,12,14,18,22,26,30,34,38-dodecaenyl]-3-methoxy-6-methyl-cyclohexa-2,5-diene-1,4-dione ; × 1 UBIQUINONE-10 × 3 FE (III) ION × 1 CHLORIDE ION × 1 PHOSPHATE ION × 1 DODECYL-BETA-D-MALTOSIDE × 1 water × 33	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2RQ24_RHORT
Isoform	—
PDB entities	2, 6
Chains and sequence ranges	Author chain 2； PDBConstruct 1–50； UniProt 1–50 Author chain 4； PDBConstruct 1–50； UniProt 1–50 Author chain 6； PDBConstruct 1–50； UniProt 1–50 Author chain 8； PDBConstruct 1–50； UniProt 1–50 Author chain A； PDBConstruct 1–50； UniProt 1–50 Author chain D； PDBConstruct 1–50； UniProt 1–50 Author chain E； PDBConstruct 1–50； UniProt 1–50 Author chain F； PDBConstruct 1–50； UniProt 1–50 Author chain G； PDBConstruct 1–50； UniProt 1–50 Author chain J； PDBConstruct 1–50； UniProt 1–50 Author chain N； PDBConstruct 1–50； UniProt 1–50 Author chain T； PDBConstruct 1–50； UniProt 1–50 Author chain V； PDBConstruct 1–50； UniProt 1–50 Author chain X； PDBConstruct 1–50； UniProt 1–50 Author chain Z； PDBConstruct 1–50； UniProt 1–50 Author chain R； PDBConstruct 1–62； UniProt 1–62

Photosynthetic reaction center, H-chain

OrganismNot specified

UniProt Q2RWS4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Light-harvesting protein B-870 beta chain × 16 （Q2RQ23） Antenna complex, alpha/beta subunit × 15 （Q2RQ24） Photosynthetic reaction center L subunit × 1 （Q2RQ25） Reaction center protein M chain × 1 （Q2RQ26） Antenna complex, alpha/beta subunit × 1 （Q2RQ24） Trans-Geranyl BACTERIOCHLOROPHYLL A × 37 SPIRILLOXANTHIN × 17 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 ;(2R,5R,11R,14R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-2,14-bis(tetradecanoyloxy)-4,6,10,12,16-pentaoxa-5,11-diphosphatriacont-1-yl tetradecanoate ; × 2 BACTERIOPHEOPHYTIN A × 2 ;2-azanyl-5-[(2~{E},6~{E},8~{E},10~{E},12~{E},14~{E},18~{E},22~{E},26~{E},30~{E},34~{E})-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,8,10,12,14,18,22,26,30,34,38-dodecaenyl]-3-methoxy-6-methyl-cyclohexa-2,5-diene-1,4-dione ; × 1 UBIQUINONE-10 × 3 FE (III) ION × 1 CHLORIDE ION × 1 PHOSPHATE ION × 1 DODECYL-BETA-D-MALTOSIDE × 1 water × 33	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2RWS4_RHORT
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–257； UniProt 1–257

Photosynthetic reaction center L subunit

OrganismNot specified

UniProt Q2RQ25

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Light-harvesting protein B-870 beta chain × 16 （Q2RQ23） Antenna complex, alpha/beta subunit × 15 （Q2RQ24） Photosynthetic reaction center, H-chain × 1 （Q2RWS4） Reaction center protein M chain × 1 （Q2RQ26） Antenna complex, alpha/beta subunit × 1 （Q2RQ24） Trans-Geranyl BACTERIOCHLOROPHYLL A × 37 SPIRILLOXANTHIN × 17 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 ;(2R,5R,11R,14R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-2,14-bis(tetradecanoyloxy)-4,6,10,12,16-pentaoxa-5,11-diphosphatriacont-1-yl tetradecanoate ; × 2 BACTERIOPHEOPHYTIN A × 2 ;2-azanyl-5-[(2~{E},6~{E},8~{E},10~{E},12~{E},14~{E},18~{E},22~{E},26~{E},30~{E},34~{E})-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,8,10,12,14,18,22,26,30,34,38-dodecaenyl]-3-methoxy-6-methyl-cyclohexa-2,5-diene-1,4-dione ; × 1 UBIQUINONE-10 × 3 FE (III) ION × 1 CHLORIDE ION × 1 PHOSPHATE ION × 1 DODECYL-BETA-D-MALTOSIDE × 1 water × 33	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2RQ25_RHORT
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain L； PDBConstruct 1–276； UniProt 1–276

Reaction center protein M chain

OrganismNot specified

UniProt Q2RQ26

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 35	Light-harvesting protein B-870 beta chain × 16 （Q2RQ23） Antenna complex, alpha/beta subunit × 15 （Q2RQ24） Photosynthetic reaction center, H-chain × 1 （Q2RWS4） Photosynthetic reaction center L subunit × 1 （Q2RQ25） Antenna complex, alpha/beta subunit × 1 （Q2RQ24） Trans-Geranyl BACTERIOCHLOROPHYLL A × 37 SPIRILLOXANTHIN × 17 (1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate × 2 ;(2R,5R,11R,14R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-2,14-bis(tetradecanoyloxy)-4,6,10,12,16-pentaoxa-5,11-diphosphatriacont-1-yl tetradecanoate ; × 2 BACTERIOPHEOPHYTIN A × 2 ;2-azanyl-5-[(2~{E},6~{E},8~{E},10~{E},12~{E},14~{E},18~{E},22~{E},26~{E},30~{E},34~{E})-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,8,10,12,14,18,22,26,30,34,38-dodecaenyl]-3-methoxy-6-methyl-cyclohexa-2,5-diene-1,4-dione ; × 1 UBIQUINONE-10 × 3 FE (III) ION × 1 CHLORIDE ION × 1 PHOSPHATE ION × 1 DODECYL-BETA-D-MALTOSIDE × 1 water × 33	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q2RQ26_RHORT
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain M； PDBConstruct 1–306； UniProt 1–306

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7oy8
Deposition date deposition_date	2021-06-23
Structure title title	Cryo-EM structure of the Rhodospirillum rubrum RC-LH1 complex
Keywords keywords	photosynthesis, light-harvesting complex, reaction centre, purple bacteria, membrane protein, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7oy8__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7oy8__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7oy8__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	44.59 Å
Rg (electron density)	43.54 Å
Total Rg	43.87 Å
Atom count	22530
Residues	2278
Excluded volume	408350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7oy8__assembly_1__model_1`	35-meric （35）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Description description	Light-harvesting protein B-870 beta chain
Molecular weight formula_weight	6083.9 kDa
Source method src_method	nat
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,3,5,7,9,I,K,O,Q,S,U,W,Y,d,m,n
Atom count atom_count	22902

EVKQESLSGITEGEAKEFHKIFTSSILVFFGVAAFAHLLVWIWRPWVPGPNGYS

Entity 2 Entity 2 polymer

Description description	Antenna complex, alpha/beta subunit
Molecular weight formula_weight	5921.0 kDa
Source method src_method	nat
Copy count entity_count	15

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,4,6,8,A,D,E,F,G,J,N,T,V,X,Z

MWRIWQLFDPRQALVGLATFLFVLALLIHFILLSTERFNWLEGASTKPVQ

Entity 3 Entity 3 polymer

Description description	Photosynthetic reaction center, H-chain
Molecular weight formula_weight	27976.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MNKGDITGYMDVAQVVLYAFWIFFAGLIIYLRREDRREGYPLEDAISGKINSLQGLGSVFSIARPKIFKLKTGATYAAPNFKRDAVAIKATRTAPTAGAPFEPTGNPMTDAVGPAAYALRDELPDLTLGGQPAIVPLRVAPTFSVAAEDTDPRGLPVVDRKGAVAGKVTDLWIDRASIAIRYLEVELAATPGRKVLLPFAATRINAKTKSKTVTVQSILARHFANVPTIAKTDSITRREEDKVMAYYSSGYLYSDRV

Entity 4 Entity 4 polymer

Description description	Photosynthetic reaction center L subunit
Molecular weight formula_weight	30660.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MALLSFERKYRVRGGTLIGGDLFDFWVGPFYVGFFGVTTLLFTVLGTALIVWGAALGPSWTFWQISINPPDVSYGLAMAPMAKGGLWQIITFSAIGAFVSWALREVEICRKLGIGYHIPFAFGFAILAYVSLVVIRPVMMGAWGYGFPYGFMTHLDWVSNTGYQYANFHYNPAHMLGITLFFTTCLALALHGSLILSAANPGKGEVVKGPEHENTYFQDTIGYSVGTLGIHRVGLILALSAVVWSIICMILSGPIYTGSWPDWWLWWQKLPFWNHG

Entity 5 Entity 5 polymer

Description description	Reaction center protein M chain
Molecular weight formula_weight	34234.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSEYQNILTGVQVRTAPHSAPIAKGIFPRLGKPGFSYWLGKIGDAQIGPIYLGTTGVLSLVFGFFAIEIIGFNLLASVNWSPMEFGRQFFWLGLEPPAAEYGLGFAPLAEGGWWQIAGFFLTTSILLWWVRMYRRARALKMGTHTAWAFASAIFLFLSLGFIRPLLMGNFSESVPFGIFPHLEWTNSFSLNYGNFFYNPFHMLSIAFLYGSALLFAMHGATILAVSRLGGDREVEQITDRGTAAERAALFWRWTMGFNATMESIHRWAWWFAVLCTFTGAIGILLTGTVVDNWFEWGVKHGLAPAP

Entity 6 Entity 6 polymer

Description description	Antenna complex, alpha/beta subunit
Molecular weight formula_weight	7112.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MWRIWQLFDPRQALVGLATFLFVLALLIHFILLSTERFNWLEGASTKPVQTSMVMPSSDLAV

Entity 7 Entity 7 non-polymer

Description description	Trans-Geranyl BACTERIOCHLOROPHYLL A
Molecular weight formula_weight	901.4 kDa
Source method src_method	syn
Copy count entity_count	37

Entity 8 Entity 8 non-polymer

Description description	SPIRILLOXANTHIN
Molecular weight formula_weight	596.9 kDa
Source method src_method	syn
Copy count entity_count	17

Entity 9 Entity 9 non-polymer

Description description	(1R)-2-{[(S)-{[(2S)-2,3-dihydroxypropyl]oxy}(hydroxy)phosphoryl]oxy}-1-[(hexadecanoyloxy)methyl]ethyl (9Z)-octadec-9-enoate
Molecular weight formula_weight	749.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 non-polymer

Description description	;(2R,5R,11R,14R)-5,8,11-trihydroxy-5,11-dioxido-17-oxo-2,14-bis(tetradecanoyloxy)-4,6,10,12,16-pentaoxa-5,11-diphosphatriacont-1-yl tetradecanoate ;
Molecular weight formula_weight	1241.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	BACTERIOPHEOPHYTIN A
Molecular weight formula_weight	889.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	;2-azanyl-5-[(2~{E},6~{E},8~{E},10~{E},12~{E},14~{E},18~{E},22~{E},26~{E},30~{E},34~{E})-3,7,11,15,19,23,27,31,35,39-decamethyltetraconta-2,6,8,10,12,14,18,22,26,30,34,38-dodecaenyl]-3-methoxy-6-methyl-cyclohexa-2,5-diene-1,4-dione ;
Molecular weight formula_weight	844.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 13 Entity 13 non-polymer

Description description	UBIQUINONE-10
Molecular weight formula_weight	863.3 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 14 Entity 14 non-polymer

Description description	FE (III) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 15 Entity 15 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	372

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	7oy8H01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	50 — Photosynthetic Reaction Center; Chain H, domain 2
Homologous superfamily homologous superfamily	10 — Photosynthetic Reaction Center, subunit H, domain 2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	519005

Cryo-EM structure of the Rhodospirillum rubrum RC-LH1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Light-harvesting protein B-870 beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Antenna complex, alpha/beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center, H-chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosynthetic reaction center L subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Reaction center protein M chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7oy8__assembly_1__model_1

7oy8__assembly_1__model_1 | I(q)

7oy8__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (18)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 non-polymer

Entity 12 Entity 12 non-polymer

Entity 13 Entity 13 non-polymer

Entity 14 Entity 14 non-polymer

Entity 15 Entity 15 non-polymer

Entity 16 Entity 16 non-polymer

Entity 17 Entity 17 non-polymer

Entity 18 Entity 18 water

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)