7pkt

Large subunit of the Chlamydomonas reinhardtii mitoribosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal_L2_C domain-containing protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DL58_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–383； UniProt 1–383

uL3m

OrganismNot specified

UniProt A0A2K3E681

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3E681_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain b； PDBConstruct 1–417； UniProt 1–417

uL4m

OrganismNot specified

UniProt A0A2K3D422

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D422_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain c； PDBConstruct 1–255； UniProt 1–255 Author chain c； PDBConstruct 291–427； UniProt 291–427

uL5m

OrganismNot specified

UniProt A0A2K3DYN2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DYN2_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain d； PDBConstruct 1–216； UniProt 1–216

50S ribosomal protein L9, chloroplastic

OrganismNot specified

UniProt A0A2K3DRF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DRF9_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain f； PDBConstruct 1–304； UniProt 1–304

Mitochondrial ribosomal protein L13

OrganismNot specified

UniProt A8J810

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J810_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain i； PDBConstruct 1–277； UniProt 1–277

uL14m

OrganismNot specified

UniProt A8IYH4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IYH4_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain j； PDBConstruct 1–120； UniProt 1–120

Ribosomal_L18e/L15P domain-containing protein

OrganismNot specified

UniProt A0A2K3D8F3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D8F3_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain k； PDBConstruct 1–337； UniProt 1–337

Ribosomal_L16 domain-containing protein

OrganismNot specified

UniProt A0A2K3DP67

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DP67_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain l； PDBConstruct 1–270； UniProt 1–270

Mitochondrial ribosomal protein L17,bL17m

OrganismNot specified

UniProt A0A2K3DXS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DXS2_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain m； PDBConstruct 27–183； UniProt 1–157

Mitochondrial ribosomal protein L17,bL17m

OrganismNot specified

UniProt A8JH49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JH49_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain m； PDBConstruct 1–26； UniProt 2–27

Mitochondrial ribosomal protein L19

OrganismNot specified

UniProt A8I7A8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8I7A8_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain n； PDBConstruct 1–312； UniProt 1–312

50S ribosomal protein L20

OrganismNot specified

UniProt A8HNL1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HNL1_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain o； PDBConstruct 1–115； UniProt 1–115

bL21m

OrganismNot specified

UniProt A0A2K3DDN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DDN8_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain p； PDBConstruct 1–370； UniProt 1–370

uL22m

OrganismNot specified

UniProt A0A2K3DSG6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DSG6_CHLRE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain q； PDBConstruct 1–377； UniProt 1–377

Mitochondrial ribosomal protein L23

OrganismNot specified

UniProt A8J6R9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J6R9_CHLRE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain r； PDBConstruct 1–226； UniProt 1–226

KOW domain-containing protein,uL24m

OrganismNot specified

UniProt A0A2K3DJU3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DJU3_CHLRE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain s； PDBConstruct 1–180； UniProt 1–180

Ribosomal_TL5_C domain-containing protein

OrganismNot specified

UniProt A0A2K3E0K7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3E0K7_CHLRE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain t； PDBConstruct 1–366； UniProt 1–366

bL27m

OrganismNot specified

UniProt A0A2K3E880

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3E880_CHLRE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain u； PDBConstruct 7–173； UniProt 1–167

bL28m

OrganismNot specified

UniProt A0A2K3D077

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D077_CHLRE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain v； PDBConstruct 1–153； UniProt 1–153

uL29m

OrganismNot specified

UniProt A8HUW1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HUW1_CHLRE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain w； PDBConstruct 1–127； UniProt 1–127

Ribosomal_L30 domain-containing protein

OrganismNot specified

UniProt A0A2K3DSP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DSP9_CHLRE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain x； PDBConstruct 1–214； UniProt 1–214

bL32m

OrganismNot specified

UniProt A8JGW4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JGW4_CHLRE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain y； PDBConstruct 1–123； UniProt 1–123

Mitochondrial ribosomal protein L33

OrganismNot specified

UniProt A8J9C3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J9C3_CHLRE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain z； PDBConstruct 1–59； UniProt 1–59

bL34m

OrganismNot specified

UniProt A0A2K3CX36

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3CX36_CHLRE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain A； PDBConstruct 1–280； UniProt 1–280

bL35m

OrganismNot specified

UniProt A0A2K3DKX8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DKX8_CHLRE
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain B； PDBConstruct 1–151； UniProt 1–151

Plastid ribosomal protein L6

OrganismNot specified

UniProt A8J503

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J503_CHLRE
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain e； PDBConstruct 1–207； UniProt 1–207

mL40

OrganismNot specified

UniProt A0A2K3D9N2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D9N2_CHLRE
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain D； PDBConstruct 1–172； UniProt 1–172

mL41

OrganismNot specified

UniProt A8J2J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J2J1_CHLRE
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain E； PDBConstruct 1–112； UniProt 1–112

mL43

OrganismNot specified

UniProt A8HW20

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HW20_CHLRE
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain F； PDBConstruct 1–141； UniProt 1–141

Mitochondrial ribosomal protein L17

OrganismNot specified

UniProt A8IWI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IWI1_CHLRE
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain G； PDBConstruct 1–259； UniProt 1–259

mL63/57/60

OrganismNot specified

UniProt A8IS96

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8IS96_CHLRE
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain I； PDBConstruct 1–132； UniProt 1–132

mL59/64

OrganismNot specified

UniProt A8HPK3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8HPK3_CHLRE
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain J； PDBConstruct 1–113； UniProt 1–113

mL80

OrganismNot specified

UniProt A0A2K3DBX4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DBX4_CHLRE
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain K； PDBConstruct 1–249； UniProt 1–249

mL87

OrganismNot specified

UniProt A8J535

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J535_CHLRE
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain L； PDBConstruct 1–206； UniProt 1–206

mL113

OrganismNot specified

UniProt A0A2K3DVD3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DVD3_CHLRE
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain M； PDBConstruct 1–523； UniProt 1–523

mL114

OrganismNot specified

UniProt A0A2K3DR53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DR53_CHLRE
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain N； PDBConstruct 1–455； UniProt 1–455

mL115

OrganismNot specified

UniProt A8J070

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8J070_CHLRE
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain O； PDBConstruct 1–596； UniProt 1–596

mL116

OrganismNot specified

UniProt A0A2K3DXQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DXQ3_CHLRE
Isoform	—
PDB entities	39
Chains and sequence ranges	Author chain P； PDBConstruct 1–530； UniProt 1–530

mL117

OrganismNot specified

UniProt A0A2K3CXJ4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL118 × 1 （A0A2K3DTE5） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3CXJ4_CHLRE
Isoform	—
PDB entities	40
Chains and sequence ranges	Author chain Q； PDBConstruct 1–340； UniProt 1–340 Author chain Q； PDBConstruct 545–693； UniProt 545–693

mL118

OrganismNot specified

UniProt A0A2K3DTE5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL119 × 1 （A0A2K3D424） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3DTE5_CHLRE
Isoform	—
PDB entities	41
Chains and sequence ranges	Author chain R； PDBConstruct 1–477； UniProt 1–477

mL119

OrganismNot specified

UniProt A0A2K3D424

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 45 RNA 9	Ribosomal_L2_C domain-containing protein × 1 （A0A2K3DL58） uL3m × 1 （A0A2K3E681） uL4m × 1 （A0A2K3D422） uL5m × 1 （A0A2K3DYN2） 50S ribosomal protein L9, chloroplastic × 1 （A0A2K3DRF9） Mitochondrial ribosomal protein L13 × 1 （A8J810） uL14m × 1 （A8IYH4） Ribosomal_L18e/L15P domain-containing protein × 1 （A0A2K3D8F3） Ribosomal_L16 domain-containing protein × 1 （A0A2K3DP67） Mitochondrial ribosomal protein L17,bL17m × 1 （A0A2K3DXS2,A8JH49） Mitochondrial ribosomal protein L19 × 1 （A8I7A8） 50S ribosomal protein L20 × 1 （A8HNL1） bL21m × 1 （A0A2K3DDN8） uL22m × 1 （A0A2K3DSG6） Mitochondrial ribosomal protein L23 × 1 （A8J6R9） KOW domain-containing protein,uL24m × 1 （A0A2K3DJU3） Ribosomal_TL5_C domain-containing protein × 1 （A0A2K3E0K7） bL27m × 1 （A0A2K3E880） bL28m × 1 （A0A2K3D077） uL29m × 1 （A8HUW1） Ribosomal_L30 domain-containing protein × 1 （A0A2K3DSP9） bL32m × 1 （A8JGW4） Mitochondrial ribosomal protein L33 × 1 （A8J9C3） bL34m × 1 （A0A2K3CX36） bL35m × 1 （A0A2K3DKX8） Plastid ribosomal protein L6 × 1 （A8J503） mL40 × 1 （A0A2K3D9N2） mL41 × 1 （A8J2J1） mL43 × 1 （A8HW20） Mitochondrial ribosomal protein L17 × 1 （A8IWI1） mL63/57/60 × 1 （A8IS96） mL59/64 × 1 （A8HPK3） mL80 × 1 （A0A2K3DBX4） mL87 × 1 （A8J535） bL36m × 1 mL113 × 1 （A0A2K3DVD3） mL114 × 1 （A0A2K3DR53） mL115 × 1 （A8J070） mL116 × 1 （A0A2K3DXQ3） mL117 × 1 （A0A2K3CXJ4） mL118 × 1 （A0A2K3DTE5） Unk1 × 1 PPR* × 1 Unk2 × 1 L1 rRNA × 1 L2a rRNA × 1 L3a rRNA (5S) × 1 L3b rRNA × 1 L4 rRNA × 1 L5 rRNA × 1 L6 rRNA × 1 L7 rRNA × 1 L8 rRNA × 1 ZINC ION × 1 MAGNESIUM ION × 69 FE2/S2 (INORGANIC) CLUSTER × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3D424_CHLRE
Isoform	—
PDB entities	42
Chains and sequence ranges	Author chain S； PDBConstruct 1–264； UniProt 1–264 Author chain S； PDBConstruct 295–334； UniProt 295–334

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7pkt
Deposition date deposition_date	2021-08-26
Structure title title	Large subunit of the Chlamydomonas reinhardtii mitoribosome
Keywords keywords	Mitochondria, mitoribosome, alga, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7pkt__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7pkt__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7pkt__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	74.82 Å
Rg (electron density)	78.00 Å
Total Rg	77.53 Å
Atom count	103129
Residues	10201
Excluded volume	1681800 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7pkt__assembly_1__model_1`	54-meric （54）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (57)

Entity 1 Entity 1 polymer

Description description	Ribosomal_L2_C domain-containing protein
Molecular weight formula_weight	41087.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a
Atom count atom_count	103129

MLRRVAQSCATMLSKQGAGAMDMAQPSTSAPMFNLANEALQAAGSGHGPAGTLLQFIRSKYTYKFKKAAPLPGLIYWKPSTPGTRHKISIDYAGLGVYTGPPHPELSAHVAKTGGRNNTGRITTRHRGGGAPKVVRDVDFDRQRVDGLPGVVQRLEADPGRSGWLALVKYSPEGQLPFYRYHLAPADVKAGDVLMSGHGAAIKPGNVLTLRDVPIGVPIHNIELVPGRGGQLARAASTSAVVTSKQDTHAVVRLPSSETRLIDLSCRATVGQVSNHLQRSINHGKAGSRRNLGWRPSVRGIAMNPIDHPHGGRTNGGRPSCTPWGVYTKGKRTRRRDASSNKFIITRAGGQPIEKFVQAKKWRARAKLEAKQRAAAGGGGKRS

Entity 2 Entity 2 polymer

Description description	uL3m
Molecular weight formula_weight	44936.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MSATGSSCALPTGIETSGGLPLQENSGDLAAASSAEASDACRAASHGLASTSLRCLATRENHSFPDGWGTLCSQGLAASGLQLQQRRGYGYQPPKPRFPLPDSIASIVEEKTREHRRSAPAPPPAPKLEPRPMTPTSLRTGCIATKAGMTQEWDEHGVRVPLTVLWVDECQVVGLKTRPVHGYNALMLGSGYKRQKCMSPSEAGFFLKAGVPFKKLVAEWQVSEDALVPVGTAIGAAHYVAGQRVDVTGWTKWKGFQGVMRRWGFKGLPASHGVSLSHRAPGSIGNRQDPGKIWKGKKLPGCMGDERRTVHNCLVYKVDAARNLVYLRGQVPGPVGRSVFLRDSRLASPALRASWGLPFPTHVPSAEELKAAPAPGDVSVVPAPDGPGVTAWRNPTDPYLMYREETDYMPVKWKKGE

Entity 3 Entity 3 polymer

Description description	uL4m
Molecular weight formula_weight	45910.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MLAGALRGCASESAFAWRQVVSAAAAAGSCSGSAGRLMVSSPCGVAQTSSPLQRWLFQGLRSSSTGAASISGGLSEAGSLPPLVLRRVDDEALSPHPPTTDVGPLTVRYPFPIEYYKDREAVIYSLDERPLGLAPLPGAAFNVPVRIDILHRVVRYWRAKWQQGTHKAKSRAEVSGGGKKPWNQKKTGRARQGSIRSPLWKGGGVSHAPRPRSHAHALPRSTRLLGMRCALSAKINEGRFFVVDDLINLRAAPLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNKNPARWSRHGLSPADRPIREYGELKRRLGALTEGSFGSSWLLVDSGEAGRDGGLRLRKLLKCSVVMEVVSPEELTVYHVLKYHRLVVTRDALQRISEALTRPHRVTKPVKHAWWARRRQAIDAAVQELTQAEAQA

Entity 4 Entity 4 polymer

Description description	uL5m
Molecular weight formula_weight	23054.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MLKLQPRSWDALPRLTAIEVSIPAIETQLERDVVDKSELLLYALALEVLAGKPAGFTAPANKALGTRATGVAVRLDAVTEPEAAHLFMEKLVHVLLPNQVGFEGVPPPMLVPPPRRSKAAEAAQARKAALDHRKAPAKAHFTEIKVGNLLTYPDFEQNFSLFEPLRGMRVRLVMEGASAADCAALLGGMSLPVLSGAAAEAALAEITAEVARRARG

Entity 5 Entity 5 polymer

Description description	50S ribosomal protein L9, chloroplastic
Molecular weight formula_weight	30622.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MQTAVAIGARAGRGALLRSLLPCISGTIESATSSQEAVERSGGLASTSSTPAHGPSCACARCFTSLAFSTTRHASTAAAAKAKGKSSKSSAGRQAGTEAADLDPGLIRVVLRKDVPRLGRRGEVVSVRRGLMRHSLYPAGEAAYATPDNIAKYGLADVERGMDAAAEQQQGGLEKLIKALDTKPVVITRRASDSDPESFAPGSAAVGARAVAAAVESQLGIRLDAASHLFLGEPIRSYGSYKVPLNLRLASEPQRQVELTVHVDRRGKPQQPGATAAAGGGSSGEGGAGAAAGAAGGAGAAASS

Entity 6 Entity 6 polymer

Description description	Mitochondrial ribosomal protein L13
Molecular weight formula_weight	29714.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MSRVTEAIKHLKDLQHIKLEGLRFRIIDAKGQVVGRLAEQISVILQGKDKPTYNPTKEQGDVVIVVNASHVELTHDKWNTKLYRWHTGYPGGLRSRPAGDQWEKDPRMLLRNAVSGMLPKNKSREARMEKLKIFPEADHPFQGFPLVPYVPPPRRLQDRGLGWPLPQGFEPANLERYAFRLRTSPALQAAAAPTVPASSALAAAPQPSAPVTGPGPAASAPAAAAAAAGTAGASGSGSGRQQRQRPTVPIDDLLTEEERAALAAVEGGKGKSGASSS

Entity 7 Entity 7 polymer

Description description	uL14m
Molecular weight formula_weight	13356.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	j

MIPKYSFLKIVDNSGAKLAQVIGFYGHQGGYASVGDVVKVVVKEARGEKTTAGVMRKAVVVEQKYPFHRQNGSHVQYLRNAAVLLSEKGQPIGNKVRSMLGVEFNKPRWAKLKSLSKRLF

Entity 8 Entity 8 polymer

Description description	Ribosomal_L18e/L15P domain-containing protein
Molecular weight formula_weight	35532.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	k

MSRSAAAGLLARLGITCQRSCSVTFQIASTIAATASSAPSCSYTQHSPGAFASAGAPRGLASLAFWTRREAAASSSISDTLSSGAQPQQQHLAASREAQQARGFAAQAAGPDHLVGLGNLRDNPGATRQRIRVGRGDGSRRGNYGGRGMKGQKSRGRGLHMLYDGGQLGLLKFPVTRQRPSYEVLYYHLGLSRVAEFVQLGLLDAGRTITMKDLYDSGCVTSNIKYGVLLYGKARLAVPLDLQVTACDADTRAAVESAGGRVTRVYYTAEGLGAVLHPEKFTSRRLPLPLPAPRWHPRYDKKFDAIGQIPPATRPVAAAALPAAAAHASGRVALASA

Entity 9 Entity 9 polymer

Description description	Ribosomal_L16 domain-containing protein
Molecular weight formula_weight	27922.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	l

MVAEGSSAATTSCSGRGLVTWTRQGPGASSALGASLPGSSVPTFARLCPNLSVTAAVQLPGGVLLQRAGLHSLVASRAGSAAGAASAARSFASPLGPLLAPTAGASAAAAGASPGSSSGLLLGGWSACAGPVRWCQAGQLSKQRVFKREGINDVIMPNTTQLRYGTYGIRAMASKRVGAATIEAVRRTLRRKIKKTARLWIRLSAVVPVTRKPLGIRMGKGKGVIDFYATPVRPGQIIFEMDRVPRKVALQALTAAQHKFPVKLGFVEWS

Entity 10 Entity 10 polymer

Description description	Mitochondrial ribosomal protein L17,bL17m
Molecular weight formula_weight	21380.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	m

ARVRVRLGDWNRLNRKWQHRVSMMKTMVTQLLEKERIRTTLAKAKTLQRYADKVITLGKQGTREAWSEARGIVRTDRELHKLFTQVALRYRERPGGFTRLVRAGWRERDAAPVAFVELVDRPGELRPANPALQRPNPLSVQAWIRQQLGQPAREPSPLLPPSVQQYLREENRIQQGRAQPVTR

Entity 11 Entity 11 polymer

Description description	Mitochondrial ribosomal protein L19
Molecular weight formula_weight	33412.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	n

MLGALLASLGASGPRALSHYSASTSSLALQSSIESIKETGAAYKALGTGWRFWSAGAGASARGDVNASSPAQAKSDESAAYASTAAPHEPAASPLNGDAQLSELLGDGGHPVASASGSSARSGGGRSPPSGLPRLSLPQRVLRDLRPPVQPYTLAPKLAQRPTTTPAQYTPWTPTRALQRRAHVSRRMGFLMHVLEREQMERVRAARPLPEFRAGDVLEVRMMVPEAERKVVVYRGVCIAVYKKGIRSSFKIYNVFPDSGGVVQHIPLYMPDLVGVKVVGRIPASQERLYYLLERETGTSDYTFQTNVSAAK

Entity 12 Entity 12 polymer

Description description	50S ribosomal protein L20
Molecular weight formula_weight	13140.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	o

MPINRQKILQLASSFRGRARTCINIARLRVEKALQHAYVGRKLKKRHWRSVWIQRINAASREHGMSYTGLITGLKAENVALNRKVLSELAMSEPFSFKALVEQVRHMRGLPPAGP

Entity 13 Entity 13 polymer

Description description	bL21m
Molecular weight formula_weight	40170.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	p

MSLVRAALSQLADSLSFGILGVNRSCWGASTSRATGLPSSISGVRLLRTLAGTGDDQRALPFNSRATVDEPFALPSTLASSTGCPTTPTPHAARLPALAALHPPAGSLLPSLCQQLRGYKSNKRSLKPLNTAASWQAVQPLLAEQRQRAAVEGVSPPVADGARPPPQPGRRRWRPRLGPIVDTCLPPIPAVPLPTECRRVGVITGQYSLEPERTFAVVELAGSQYKVTTDDVLFVNQLKGVAVNDVVALERVLLLGSRAETVVGRPYVPGGVVLAAVEEHFRDGKVHVFKKRRRKRYRKYQAPRPHLTTLRILQVRGIDPAPGDESARLPELPVALLDARYESVLRLTGRGEQQQQQQQQQDEEQRQAAA

Entity 14 Entity 14 polymer

Description description	uL22m
Molecular weight formula_weight	39180.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MSGAETHRLALLASSRALIARVQLGDAPAALSQALSTLSSVIYASTSYGRSECSCSSSSGREVQPSATPASPATAQTSRVAPFLALQRPSAAFSRLGLSTWAPHASVSGWHGARQLHAGSAAQQAADVPGGSASGSGGKESEGAAKPQEQTVTNPLAAALASAASGPVASGSASAAGGLAQAAQAAAGRGRRQPRNWMWYDADDEREERRKERQRLAWAMGPGGGEEVGAAHLMDVPQSMKKMQRIVKLVRGLPYPDAVAQCSLVPHKAARYMLQALEAAHADATEVKGLDAERLVVGTVFVTRGAYEPGISYHSKGRPGSKTFHRSHIRVVLNQAAERPAPFARIVAPLMSRRGLLGGSGGAGGAPRPRFAYRTEV

Entity 15 Entity 15 polymer

Description description	Mitochondrial ribosomal protein L23
Molecular weight formula_weight	25593.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MRWQHSAAEQTASTRAIKGSADDTPSAAPEQETRLRFVSSEWRSGRPQPPERRIPICFPNITLQMMKLTPEQMDQVKETGWLREVAFKTTPDVTKLEIAAFLQSVYGMNVERVSTINYLGRRRLAISRNGKRLWWREDDWKKAYVIFRPPAGQEHLLTRGRRAGGDGDSGDEEQQRPVIEQIREAARAPRLPPRPYPWERRPGGGRRGAPGGEAEVPGGRSGDAAE

Entity 16 Entity 16 polymer

Description description	KOW domain-containing protein,uL24m
Molecular weight formula_weight	31164.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MPQALYRSIQPMFKTNRWRICRDDLVYILSGPDKGKTGKVLEIIKDTRTPQVIVEGRNLRKKKVKTGTGPDDFFVVTMEAPLHYSQVQLVDPQTGKPMRVIFAYTADGTKVRSRKVPNPSTADIIATPSEEDPDPRVGLTGPKDTSASLARQATYTPSAGFPFRVRNLERIWAELQPDADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 17 Entity 17 polymer

Description description	Ribosomal_TL5_C domain-containing protein
Molecular weight formula_weight	38730.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	t

MRCATGATASLLPAARSWAVSMLTSGLDHGLGVSVLGGGPLPGLLARARHDSALAQRASEQVVPPEILRELQQLEGSLNDAARLDGRRRSSLRLSQSTLPLPLPTHTVEPGLPALDAHVRPRSATGGTACKWLRRAGRVPGRVHSLPGADARAGAAAGHSEDQGASSSSSNINNNNNKLLVHFSEGDVAKLIRTFGRNGCTARVLQLNLVAPDAAASDSGAEQAAQADAGRSGEGTSGSTSGTQLGMLRVKPTRVFVNAVTQRVEGLDLIYCPPERQVLVDVPVRLLNDDLAPGVKKGGWIALFKRTVRYKALGGAIPPYIEVNVRNMDLDQDMLVRDMPIPPGTKLYEKDYNAPVLRCTTDVGKD

Entity 18 Entity 18 polymer

Description description	bL27m
Molecular weight formula_weight	18010.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	u

XXXXXXMKLTAGELAFPGMIILRQRGTKFHPGANVGIGRDHTIFATGVGKVRVDTQPGPRGERRVVSVEPLPEALAAASSPATPGAAADADSALRLRQVEAELVKRRAEVKRAMLQGRTPLEPALYFPLPRTADGQLSWLERSVAKAPAVTPSAAAGKDAVPAKPKAAAKKAS

Entity 19 Entity 19 polymer

Description description	bL28m
Molecular weight formula_weight	17000.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	v

MSSNVRQLISRLIPPARKQFEHLQAHRRDVVWGDTQITLRVRQYPKSKDERVSLVLPNWHRVRLWSEALGRKVELVMTKDTLRHIEDMGGLDAYLIKTPESRLKSNPASAVKWEVMSALRRREAAAMMARGGRGGAAGGDGSGAAGAAGKEST

Entity 20 Entity 20 polymer

Description description	uL29m
Molecular weight formula_weight	14799.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	w

MRFDVENQGGLACVPKPCVSSTGRGWKVEELRLKSWQDLHKLWYVSLKERNLLLTEMGLKHIPKDAAHQVMRRIPVGAASVEEDPHRLRYTEVQNTLRHIRQVLEERAAAELVPKLRREMLEVINAR

Entity 21 Entity 21 polymer

Description description	Ribosomal_L30 domain-containing protein
Molecular weight formula_weight	24367.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	x

MATEGSVQAVKSLFVTLRRGFAGTPWFHRRVLESLGLKYRHQCVEKPNNSSIRGMLSKVPHLVVIETDRMRYLRELKEHYQQLPREPWVLHHDPPLPAATPSNPSSPLASTSSSDSDSTELLTPAPLPPSVPAQPRLTPFAASQLREHVEPVGLEGYRANKQPPLPPRKYFQEQSRRWRAKVLTERGVFSADACREHAEAIRPKSYRRRTGIRD

Entity 22 Entity 22 polymer

Description description	bL32m
Molecular weight formula_weight	13370.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	y

MDSTSHPSTSYVVAPRLPAEEDDTFVPFSRPSPSPFGSGNSLLPQLCATPKKKLSLHRRGNRRVWYWLKRKTEVAKCSYCGALSGRNQMFSGAAGNSACTGQCVEQAPTPPASSYPAEYKPPC

Entity 23 Entity 23 polymer

Description description	Mitochondrial ribosomal protein L33
Molecular weight formula_weight	6864.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	z

MSNGGKKGVRLLVKLVSTAKTGFFYVTEKNPRNTPWKLKLMKFDPKVNKHVLFEEQKLK

Entity 24 Entity 24 polymer

Description description	bL34m
Molecular weight formula_weight	29646.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MASSSSVIARAGQYGSLLLQGPALSQATSNLGSLFSSTQAPPSADLSFSERSSFALERLDTLTASSSGRQHASGDAGLFVGFGGGAGGPLTAAHDSGLAPTICLWDSRLVSFDVSRLLAEAHRGRHQPQTLSAQQPQLSHQELLGAHQHLPRLQMHLGGADGVTPRLQLHAPLTPPELWAPHVLPGAPRPLQPHQPHQPPAPAGLPATPAPAPAPAPPAPGGPAPAPLRCGNRGNTYQPSRRKRVNRHGLEKRLSTPQGREVLLRRLRKGRWRITVDSFR

Entity 25 Entity 25 polymer

Description description	bL35m
Molecular weight formula_weight	17494.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPWSLAHTPRGLFGAARPLVNPQIHAHDKYKKENPQPANSFLLGRFVTDRNGIIWHRQANYRHARHAKSASQLTRLKRWKPLAPAFAAKLRKLGFSERYWAAPDPQDVPGFHSPRGRVERPRRSAVPDMDHTTGEPALRQSWQPPNRQRLR

Entity 26 Entity 26 polymer

Description description	Plastid ribosomal protein L6
Molecular weight formula_weight	22275.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MLTTRVKPFRAAAVSRSSRLCVVAKDSRIGRAPITVPKGVTVTLEGQLVRVKGPNGTLEQTLSPLVKIEQADGKLKLFKLADDRVAMSQHGLNRSLVNNLVVGVSTGFEKRMEMVGTGYRAAVAGKDLTLNVGYSKPRVLAIPEGLKVVVEKNTTLVISGADKVKVGDFCATIRRQRPPEPYKGKGIRYAGEVIKLKEGKGAGGKKK

Entity 27 Entity 27 polymer

Description description	mL40
Molecular weight formula_weight	17749.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAGFTKATSTKGAAMKRNKGAASGGVDEENARVKAMVAMLQPPAPAEATPLTPAEQAAAQQLQQQRVAEHQAWVKDMTTKFKLQQAALRALPERLRVLAMQPDHTPYPLNRKFLFDSPPAAYRDTPAGKTASGASAAAEASAGAGKGAEAASGGGKQAGGKQGGSRKQQGGR

Entity 28 Entity 28 polymer

Description description	mL41
Molecular weight formula_weight	12623.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MTVRSIVVSLIRGANKASRQHQGDIGREAVVDLIQQSAAKQSGIRKGWQVKAATWVKRVHVDRGDVKVGRLEGGEFQVLPHLRPRYFVPADLDKFQLKPYVEVEKKVEAAKQ

Entity 29 Entity 29 polymer

Description description	mL43
Molecular weight formula_weight	16217.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSKYGVWMLESLVIKYCDIGGSSRGMRLFLDEALPALRQQNPQLGVQQVLQRFRHPKLVAVYRNGRTKPVCVKNLAPAEIMEHIGWLRNSHGRGQEYQVVRSRHLSRSPSIQGTWSVDTFASQLERVNEARRAREAAQTQY

Entity 30 Entity 30 polymer

Description description	Mitochondrial ribosomal protein L17
Molecular weight formula_weight	27320.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MRSAGSLIAKSLFAVSTCGNRSCAGLLTRGYGAEAASATVNDGASTSGEGPIIAACVLQRLPLVRPRLTTGEQAQLALERQRALQTGELKDYPQNMAVTGKDDAGSKQQQQDLRAFDPVPATTAADSNGDVSTMRRRLADSLYLVVRGGPAAGGGGGEWAFPQAVNTAEESISDTAQRALYGAIGRSHPVYFIGNAPMGHVRALPAGTSFFMLAQVVDDPWDTQLLPGAAQELAWVTKQELLGSYLSDARLRELVSKML

Entity 31 Entity 31 polymer

Description description	mL63/57/60
Molecular weight formula_weight	14645.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MFFSRCVMVVFKTTGGRSWNPPSGLRPLSPAQRRNRTKNLALTMKNMSILKLAEANQPEVPVRLYKPLNFSRMQWMKKKLEETRAALGWDMEARALQEQARALRVGGGRQGAAGSLLPPAARAALQGSVGDK

Entity 32 Entity 32 polymer

Description description	mL59/64
Molecular weight formula_weight	14372.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MAHLLARLGAKALLPRRDGDKLLPPLIGAAEALRLREQFYAIGQQWPYENIVPGKPPSPPGCKAYLERQKAKEAKRAARAKQVAEAMANMPKTVADYKASRRLDWSEVSALDRXXXXXXXXXXXXXXXXXXXXX

Entity 33 Entity 33 polymer

Description description	mL80
Molecular weight formula_weight	27176.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MHASVSGSLDTAPSSSSGTALATASTSSAPLDLREQRHLYLDGTRTADPGEPRYTAPYWVPPSARAGIPNILFSEPWPSHEEPQLRRQHAAMCLEALKRADRPLTAEQVHEAVNSTAGYSASASAGDAGDSGAGADKPVLSTLAYTKKLLEHLRRTRFVYGRKNPDSMLSPGHPDHPRLYEALPFQAARYGKPETLAAADEAARAAAIAKAQKRLRNGKAPYPQHRRRARFSIWQHELAQEALRELQAK

Entity 34 Entity 34 polymer

Description description	mL87
Molecular weight formula_weight	23535.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MLALLAVRARSPSLPSITLPARLLSTQTSASVSETYSNRPTSSAESTEAVSSSGQSASKWDWKWVLGKASGRKPAITRPRRHQWHYCNPEYDPAAPLPEVLRSPFGPPGAERSHDWATYARHLQLQPENRRDLKRYRARFVRFMQLRELDWREAFQRGVAEDSRVSNKVARAKAEAQRQDAWSDYKQAMWQRAQLADSHQSHGTGR

Entity 35 Entity 35 polymer

Description description	bL36m
Molecular weight formula_weight	3081.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 36 Entity 36 polymer

Description description	mL113
Molecular weight formula_weight	84437.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MRQLSLSLLARLGRGSRGSLQPASSAINSGVDPGVLSGEECSTSAPAGMPSWLRHSRRYAHQYNLIQPVDTNHINALLSSATALEHAAVPVLRYSAWFDPEQVTRTMQRVPRMLQYQRRKGRRGAAYASSPSSSADLARSLLDALGSRLAALAPACSDQQLARALWALGAARHPHPQALAAACEVLPQRLKGASGAAAAAGAGSGAGGMAMTDLATAAWGLAAAASAGPQSVREPVRRALQEVARHLVASRPADLSATPALPQPSSPSSISSPSSGAVAPAADEVAAAASAAALAADRPWLDPRSAVKLAWAFASCEVKDAAALDVVAEAAEARIASQLQAHDPTTGPLTPRATYMYQTIRGWQAWPRPRPRVIRSAASAARGGRSRYLYDDRPRVVLRDFTAGSLAQLLAALAAAGHRHEGLMQAAAAHLTASSGRSLRVDPHDLKRLAAAFARLDLAAPAAASGGAATAAALTALLSAAQLSSLPAPLLARLAILAAESGVRRRSVYDRLVRQLMARAWVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 37 Entity 37 polymer

Description description	mL114
Molecular weight formula_weight	48757.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MRRAVARCTAQIAAEACSVSSACSTSGRQVQEQLDNCLRWMTYARPRSRIDYYDPTRNVYKEFQRKWDRANAAAAAAASQAEAAAARPSHSAPPSAAPQQQPYGGAGSYPFGSSLTTPCSSYGSGYGAGYGGTAAAGADWPPGYEALLQTYLEQELPLSAEEASTLVAAAKKGLLPGSRSLIRTRFMHIKDLEPRFPGFDARAAVLGEPRLLRHAADKVMRAMLVFQDHWPSHPVGPLMGRIGCPVIRDPAGVGHRLYALTRALKTDLHYELDPHRLTPESEGFLASGVSPFELEARVSALVTIFGREGAGRLLDVSLDVLTYAPRDLDRAVLALREVFSAAGDRGYGRHSLSTPEGAAAAAADRGYVTDLAVAWPGVLALPGRLGGADGVARLLARVRRAGGARYRGAVGRRALLSEVLERPELLQAAAEAAMRGEEEDEEEDVEGRAELEGKV

Entity 38 Entity 38 polymer

Description description	mL115
Molecular weight formula_weight	72344.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSIALLCRRQGRGLARALSLIESGASIERDVAITDENIRGSDAGACSTSRQCQPDTPIGGFRQWPRSLQLWRGFAVNNKPSLKYVPVPESQHDDFTSEPTTYTQLLASIRAAKSLKRLEHLVDTYADRFDAVHVAAAVARLPHLLKYREADLVDMSASAVVLPSGMTRTRRKHGAQLRSGSAEVAARLAARVDAMLPQHVAHFFPRQAACSIWAFGELRRHGVIERMDSLPQVLMSVTRGNLQPLRVHAAGVDFAQLLHGLAKLGHNDEPLLDALLPLVTERLGSMQQRELQMTVWALATLRRATPELLDEVAQQLLSTSTAFLLPSACASVFWSYAKTEGLARLSPGGEGGARVSRRRARVAAARVKLFDSLAATMMAQALLLAPQDVATTLWACSVLGYHHSQLPAVLGDAVLRALPNCSDAEVASVLESLAHLGYHHAPLMDAVAAGILAEPVVSTEPVNIARVLYAYGVLARRGPRDLQLVGTLAEALVRRLARVERLDTVALACRGLGAFAYDDQAVLAQVAARTEQLLQTSTTGLEQLQAVLRCLDAGGCSYFQLAVAAARMLDDRLRAGACRSAPLAVEVLYYSARQGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 39 Entity 39 polymer

Description description	mL116
Molecular weight formula_weight	53018.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MRQQAGMLLGEAVASTSGRASPALQLIIQRTLSLVASGIPSPRADVALQLSTPHGGHINRMINTSESIVELDSILYRFRKRLRPANIGAAAMRLEHLNRLERRTPYALRVQRVAAELQKYVATYTDRLALTQAANVLRGLSAVRHRLPPELVLRLAAGAVADGGAALRLAPDVDVRDLCFGLAGQGFNNTAFWARLCAAVLPRLRSFDPNTLPALVTALQAAQQLPAPASASASSGSAGSAVAAAAGGSTPQAAVAAEALRLLSRSETLAALAPARLADAASLLAGLGPALGVAVDARLVEAVQTATARALPSLSPNQLPGLLLAVAALRRAAAPAEAAAAAAATAPQQQLPAALLATALPHLSAGAVTMDLTAVMRAARLLAPHAAEPAAADTLVRLARRTLLLLPAPGSSTGGPTGSASGSSSSNGEGLVTLSRVPRGGQAAGAVLAAAAPAGQLQGRTAGAVEGVARAFAAAAPAVAPQPALVGELAARLAAAGEAAAARGLLDEAQLASLGRSVEVLAAAGAAKSG

Entity 40 Entity 40 polymer

Description description	mL117
Molecular weight formula_weight	75804.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MLQALAGGALGGLQTNGPANLVGALGLLQRAAAAVVTGVPSSSSPVPPHADRSLASLSAGAQSAAESACSHGGCGHDEAPCCSARSSSNSSSDAGAPRGLQQQLRSQQLQQHQHQQRRGIATSAGSALAYKFQSNVSPASSRGSGRGSKVATRDNYQRWRESGGDVRVAQDILREAEGSGRGGGGGGGAGAARRGDSRLRRGADRPGGSGAGSGGGTGAGAGVVDVQDELRAMVLGCRDLSELQVVVCECGADLNPFLVCAAAARLHKLKQATPPGASPAALARRVGESLMVLLQDRAAEAPLSQLAGAAHGLAEAGLAPGAALLEALAARCEAASPRGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAASELGAGMLRPLCDALTPRVPALSCADVASLATGLAAALGAAGGEAAAAAADGAPPLLSPSHFGSLPRLLSDLLLLRGPGQFGGRNFASVALALALVTGGPAGAGGGGAAAAGSLPPAFWSKLAAVALPEVPAMDAGSLSRLAGAFCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 41 Entity 41 polymer

Description description	mL118
Molecular weight formula_weight	64122.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAFLVAARRQLKGGLSLAEVALPVSVLGTCTRSNAVFTEALAGCSGASLHCSAEQPLSRATSYSDAGAGAAGVPACGSASPRQPSPEPCSSSGSHATFNSLGRYRSQHVGISRGASALSALAEASASPSPASNLPRGQHQHQQHHHQQLRTYHAWYYGSKLRNRAISQAESLEELGEMLVREGHRLDHVNLTALLAQLKRVARAAEEEAVAEATGGSSSSSSNSSSSGSSAVTAAAAAAAARAVRVRVAELAAVAARLVRRRAKWYDPRHAALAVAHTAALRHTDGRLLHDMTGRALARLDEAYSRDVLLLLRGLCAHQHMQQLAAASSPPAVAAAVAPAVPAVAGAGKPYGGAPAVLLGGVKVFLTAKVPTGRMPPENLAGLLRHWRALAPPGRRLGPAVCGVVAADLQTRTAIYAPEPLAGVLATLSAERHALPPPLLDAAAEQFAAHALTHGSGAAAARFLAAVGAQLRLQQQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 42 Entity 42 polymer

Description description	mL119
Molecular weight formula_weight	36808.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MATGAVAASAADTASTSAPAPPSSSPFMPRWLRNLFPGGEHLPASPAMERQTSGASASSSGGSGPGSEADDIKQLEEMRNMDMQGYVEYCKKMRGGAPPPRPRRPSVSPDHYDYRTMQDQRRIAFLRMQQHEHIGSLVTKEESDLILAKREDVVKNRALLQAIADRTGVYIDLEVKDCIEQFLETRENAGQMHRYATEFGMPLPKGSQEQREMRRFMKRVEAEEKLAVALEKRDLTSCSLRHKLSWAGPTALCDQTTLRYHECCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKREVVDKDRERQVHGMFKSRAEGILRKAAMDGVKPRLRDY

Entity 43 Entity 43 polymer

Description description	Unk1
Molecular weight formula_weight	2656.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 44 Entity 44 polymer

Description description	PPR*
Molecular weight formula_weight	14656.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 45 Entity 45 polymer

Description description	Unk2
Molecular weight formula_weight	4188.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 46 Entity 46 polymer

Description description	L1 rRNA
Molecular weight formula_weight	51976.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	1

GGGAUUGCUGACUGAUAGUGCAAACAGUACUGUGAAGGAACUAAUGAAACUGGGCUAUAAGUGCGCAUUCCACCAAUACGUGAGCAUUCGCGCAUUACCAUUCUCCAGAGGAUUUAAAUGCACAAACCUAUAUGCCUUUUGGCAUAUGAUUACACUUCGUUA

Entity 47 Entity 47 polymer

Description description	L2a rRNA
Molecular weight formula_weight	27512.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2

CAGCUAUAAUUUAGCGUACCUUUUGCAUUAUGGGUUAGCUACUCAAUAGACGUGAGUUAAGCAGAAAGCUUACUGAGAUUUUUUUA

Entity 48 Entity 48 polymer

Description description	L3a rRNA (5S)
Molecular weight formula_weight	24033.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	0

GGUGCUCGGUGAAACCGAGCAUCCAAUACUAAAGAAACUUUACUGGCUUAGUACUGGGACCCCAUUUUUAGUAUA

Entity 49 Entity 49 polymer

Description description	L3b rRNA
Molecular weight formula_weight	59395.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	3

ACGUCUAUUGGACCCGAAACCGAUCGAUCUAGCGACGUGCAGGUCUGACUUUAAUCAGGACCGAACCCGUGUCUGUUGCAAGAGACUGGGAUGACACGUGGCUAGGGGUGAAAGGCCAAUCAAGUUCGGUAAUAGCUGGUUUUCUGCGAAAUCUAUUCAGGUAAAGAGUGUGUACUAAGACCAU

Entity 50 Entity 50 polymer

Description description	L4 rRNA
Molecular weight formula_weight	38253.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	4

AUACCGGUAGCGCAAGCGAAUGGUAAUGGAUCUAAUACAACACAUUCAGACAAUCGGCGGUAAGGUCAAUUGUCAAGAGGAGAACAGUCCAGAGGCGAGGCUAAGGUGCCUAACAAUU

Entity 51 Entity 51 polymer

Description description	L5 rRNA
Molecular weight formula_weight	47720.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

AAGGUAGAGUCUGCGUUGAACACCAGAACAUAGGCUUGGAAGCAGCCACUGUGCUUGGAAAGCGUAAUAGCUCACUGGUCUAGCAGUCUCCGCUUAUAUAUGUCCGGCACUAUUGCCGAAGCCCGCCUAUGACAAAUUUUUUUUUUUUU

Entity 52 Entity 52 polymer

Description description	L6 rRNA
Molecular weight formula_weight	43923.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

AGUCAUAGGUAGCAGAACGUUCUGGAACAAUUACGCUGAAAACAGUAACAGAAUUGAAGCUGCUAACAUAAGUAACACUAAAUGGAUAACAUGGCCGUAAGCCCAAGGUUUUGCAUAACAAACAGUGAAUACGGUU

Entity 53 Entity 53 polymer

Description description	L7 rRNA
Molecular weight formula_weight	186482.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	7

UACCGUACUGCAAACCGACUCAGGUGGGCUAGUAUAUAUACUCAGGCCAUAGAAUCAACCAUGUUAAAGGAACUCGGCAAAAUGCACGCGUGACCUCGGAGGAAGCGUGGCUAAAAAGACUCAGCAAAUAGCCGACAGCGACUGUUUACCAAAAACACAGGAUAGUGCUAACAGACGUAAAUUAAGCUGCAAAAAGCGGUUUUAUUUUUGGAUGUAUACUAUCCGACGCCAAACGGCGGCAGUAACUCUAACUGUCCUAAGGUAGCGAAAUUCCUUGACUUGUAAUUGGCGUCCUGCAUGAAUGGCGGAACGACUGUCGGGCUGUCUCUAACAUGGAAUCUGUGAAUUUGAAAUCUUCGUGCAGAUGCGAAGGCGCUGGCAAGGGACGAAGAGACCCUAUGCAGCUUCGCUGGGUGCUAAGAGUUACUCUUAUCCUCAAGCUUUUCUGGGACGGAUGCUUCCUAAAUAGUAACGGGAGUGAUCAAUGGUACUGCUACUUAAAUAGAAAGCAGUGCUUGACUGUAAGAACCACAGUUCGAGCAGGGACGCAAGUCGGCAUUAAUGACCCAGGGUAACAU

Entity 54 Entity 54 polymer

Description description	L8 rRNA
Molecular weight formula_weight	132907.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	8

GUUACCCUGAUCAACGGACAAAAGCUACGCUAGGGAUAACAGGCUUAUCCGCCUUUAGAGUUCCUAUCGAUGGGCGGGUUUGGCACCUCGAUGUCGGAUCAUCGCGUCCUGUGGCUGAAGGAGGUCGCAAGGGUUGGAUUGUUCGUCCAUUAAAGUGGUACGUGAUCUGAGUUCAGACCGUCGUGAGACAGUUCGGUUUCUAUCUUUGUCAGCGAAAGGCUUGUUUUGAAACGCCUAUGCACAGUUAGCCGCUGGGGGCGAGUACGAAAGGACCAGACCCCUAUAAACCUCUGGUACACUUGUUGUCAUUUACACGGCAUAGCAAGAAAGCUAAGUUUUAAAAGGCUAGAUUGCCUACAUUCAAUAACACCGAAUGACCCCGACUUACAAAAAGUUUAGGACUAAAUUUAUGA

Entity 55 Entity 55 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 56 Entity 56 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	69

Entity 57 Entity 57 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	101291

Large subunit of the Chlamydomonas reinhardtii mitoribosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ribosomal_L2_C domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uL3m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uL4m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uL5m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L9, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

uL14m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal_L18e/L15P domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal_L16 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial ribosomal protein L17,bL17m

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer