SAXSdb — 7pwx

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;

Mycobacterium tuberculosis H37Rv

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Orf20 × 3 （Q9F0J8） 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 2 1,2-ETHANEDIOL × 6 DI(HYDROXYETHYL)ETHER × 2 water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Orf20 × 3 （Q9F0J8） 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 2 1,2-ETHANEDIOL × 2 DI(HYDROXYETHYL)ETHER × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DUT_MYCTU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain HHH； PDBConstruct 1–136； UniProt 1–136 Author chain III； PDBConstruct 1–136； UniProt 1–136 Author chain JJJ； PDBConstruct 1–136； UniProt 1–136 Author chain KKK； PDBConstruct 1–136； UniProt 1–136 Author chain LLL； PDBConstruct 1–136； UniProt 1–136 Author chain MMM； PDBConstruct 1–136； UniProt 1–136

Orf20

Staphylococcus aureus

UniProt Q9F0J8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	;Deoxyuridine 5'-triphosphate nucleotidohydrolase ; × 3 （P9WNS5） 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 2 1,2-ETHANEDIOL × 6 DI(HYDROXYETHYL)ETHER × 2 water × 6	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	;Deoxyuridine 5'-triphosphate nucleotidohydrolase ; × 3 （P9WNS5） 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 2 1,2-ETHANEDIOL × 2 DI(HYDROXYETHYL)ETHER × 2 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9F0J8_STAAU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AAA； PDBConstruct 1–147； UniProt 8–154 Author chain CCC； PDBConstruct 1–147； UniProt 8–154 Author chain DDD； PDBConstruct 1–147； UniProt 8–154 Author chain EEE； PDBConstruct 1–147； UniProt 8–154 Author chain FFF； PDBConstruct 1–147； UniProt 8–154 Author chain GGG； PDBConstruct 1–147； UniProt 8–154

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7pwx
Deposition date deposition_date	2021-10-07
Structure title title	dUTPase from M. tuberculosis in complex with Stl
Keywords keywords	dUTPase, dUTP, DNA, Mycobacterium tuberculosis, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7pwx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7pwx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7pwx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.67 Å
Rg (electron density)	29.63 Å
Total Rg	30.22 Å
Atom count	6139
Residues	816
Excluded volume	109270 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7pwx__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7pwx__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;
Molecular weight formula_weight	14209.3 kDa
EC 编号 ec_number	3.6.1.23
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	HHH,III,JJJ,KKK,LLL,MMM
Atom count atom_count	12287

MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLA

Source Source

Source organism organism	Mycobacterium tuberculosis H37Rv
NCBI taxonomy ID ncbi_taxonomy_id	83332
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Orf20
Molecular weight formula_weight	17179.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CCC,DDD,EEE,FFF,GGG,AAA

AELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEIYGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYDETIKLLELLKESKINVNDIDYDYVLKLYKQILST

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL
Molecular weight formula_weight	122.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	95

▶

Unit-cell length a length_a	79.407 Å
Unit-cell length b length_b	150.429 Å
Unit-cell length c length_c	107.370 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	98.85 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.750 Å
Low-resolution limit resolution_low	75.328 Å
R factor r_factor	0.2037
R_work r_work	0.2007
R_free r_free	0.2587

dUTPase from M. tuberculosis in complex with Stl

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;

State in the Current Structure

Other States of the Same Protein in the Database

Orf20

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7pwx__assembly_1__model_1

7pwx__assembly_1__model_1 | I(q)

7pwx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

dUTPase from M. tuberculosis in complex with Stl

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Orf20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7pwx__assembly_1__model_1

7pwx__assembly_1__model_1 | I(q)

7pwx__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)