7rhq

Cryo-EM structure of Xenopus Patched-1 in complex with GAS1 and Sonic Hedgehog

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Patched-1

Xenopus laevis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 3 其他Polymer 3	Sonic hedgehog protein N-product × 1 （Q15465） Growth arrest-specific protein 1 × 1 （P54826） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CHOLESTEROL × 2 CHOLESTEROL HEMISUCCINATE × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ZINC ION × 1 CALCIUM ION × 2 PALMITIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q98SW6_XENLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1178； UniProt 1–1178

Sonic hedgehog protein N-product

Homo sapiens

UniProt Q15465

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 3 其他Polymer 3	Patched-1 × 1 （Q98SW6） Growth arrest-specific protein 1 × 1 （P54826） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CHOLESTEROL × 2 CHOLESTEROL HEMISUCCINATE × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ZINC ION × 1 CALCIUM ION × 2 PALMITIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SHH_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–192； UniProt 24–197

Growth arrest-specific protein 1

Homo sapiens

UniProt P54826

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 3 其他Polymer 3	Patched-1 × 1 （Q98SW6） Sonic hedgehog protein N-product × 1 （Q15465） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CHOLESTEROL × 2 CHOLESTEROL HEMISUCCINATE × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 ZINC ION × 1 CALCIUM ION × 2 PALMITIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GAS1_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 5–282； UniProt 40–317

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7rhq
Deposition date deposition_date	2021-07-18
Structure title title	Cryo-EM structure of Xenopus Patched-1 in complex with GAS1 and Sonic Hedgehog
Keywords keywords	GPCR, complex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7rhq__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7rhq__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7rhq__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.01 Å
Rg (electron density)	43.02 Å
Total Rg	43.42 Å
Atom count	10499
Residues	1305
Excluded volume	189400 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7rhq__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	Patched-1
Molecular weight formula_weight	134622.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	10499

MASAACAAELGASGEAAAQPRVVRRRGRSRRVAPPDHDYLQRPSYCDANFALQQISEGKAIGRKAPLWLRAFFQRQLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLRAANLETNVEELWVEVGGRVSRELDYTRQKIGEEAMFNPQLMIQTPLEDGANVLTTEALLQHLHSALEATKVQVYMYNKPWKLEELCFKSGELITEAVYVSQIIDSMYPCLIITPLDCFWEGAKLQSGMAYLPGKDILQWTNFDPLELLEELKKGKLHIDIWEEMINKAEVGHGYMDRPCLNPSDKNCPYTAPNKNSTKPVDVSLILSGGCYGLSKKYMHWQEELIIGGTVKNASGQIVSALALQTMFQLMTPKQMYEHFKGHEVVSHMNWNEDKAAAILEAWQRTYVQVVHQSVPQNSSQKVLPFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREVRRLDIFCCFSSPCVSRVIQIEPQAYTDNNDNTRYSLPPTYSSHSFAHETQITMQSTVQLRTEYDPRTQLYYTTAQPRSEISVQPAASTPQDVSGQTPESTSSTRDLISQFSVHGGSMQCTPDSKWTLSSFAEKHYAPFLLKPKTKVAVILGFLALLSVSLYGTTRVRDGLDLTDIVPRETREYDFIATQFKYFSFYHMYVVTQKADYPRAQRLLYELHKSFVGVRYVLLEGNKQLPKMWLHYFRDWLQGLQDTFDHEWEAGKITRNDYRNASDDAVLAYKLLIQTGNSDKPINLNQLTKQRLVDADGIIQPNAFYIYLTAWVSNDPVAYAASQANIRPHPPEWLHDKADDRPETRTIRAAEPIEYVQFPFYLNGLRETSDFVEAIEKVRAICNNYTSLGVSSYPNGYPFLFWEQYISLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAVGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFAVLAILTLLGVLNGLVLLPVLLSFFGPYPEVSPTNGSSSPAAAHHHHHHHHEDQVDPRLIDGK

Source Source

Source organism organism	Xenopus laevis
Common name common_name	African clawed frog
NCBI taxonomy ID ncbi_taxonomy_id	8355
Host organism host_organism	Insecta environmental sample

Entity 2 Entity 2 polymer

Description description	Sonic hedgehog protein N-product
Molecular weight formula_weight	21378.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

CGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEGGTEDQVDPRLIDGKSGGDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Growth arrest-specific protein 1
Molecular weight formula_weight	29546.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

GPGSLAHGRRLICWQALLQCQGEPECSYAYNQYAEACAPVLAQHGGGDAPGAAAAAFPASAASFSSRWRCPSHCISALIQLNHTRRGPALEDCDCAQDENCKSTKRAIEPCLPRTSGGGAGGPGAGGVMGCTEARRRCDRDSRCNLALSRYLTYCGKVFNGLRCTDECRTVIEDMLAMPKAALLNDCVCDGLERPICESVKENMARLCFGAELGNGPGSSGSDGGLDDYYDEDYDDEQRTGGAGGEQPLDDDDGVPHPPRPGSGAAASGGRGDLPYGPGRRS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	CHOLESTEROL
Molecular weight formula_weight	386.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	CHOLESTEROL HEMISUCCINATE
Molecular weight formula_weight	486.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 10 Entity 10 non-polymer

Description description	PALMITIC ACID
Molecular weight formula_weight	256.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.53 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	54175

Cryo-EM structure of Xenopus Patched-1 in complex with GAS1 and Sonic Hedgehog

1. Protein Identity and Related Structures Protein Identity & Related Structures

Patched-1

State in the Current Structure

Other States of the Same Protein in the Database

Sonic hedgehog protein N-product

State in the Current Structure

Other States of the Same Protein in the Database

Growth arrest-specific protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rhq__assembly_1__model_1

7rhq__assembly_1__model_1 | I(q)

7rhq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

7. Citations (1)

Cryo-EM structure of Xenopus Patched-1 in complex with GAS1 and Sonic Hedgehog

1. Protein Identity and Related Structures Protein Identity & Related Structures

Patched-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sonic hedgehog protein N-product

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Growth arrest-specific protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rhq__assembly_1__model_1

7rhq__assembly_1__model_1 | I(q)

7rhq__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

7. Citations (1)