7rpk

Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein dispatched homolog 1

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Sonic hedgehog protein × 1 （Q62226） CHOLESTEROL HEMISUCCINATE × 26 Lauryl Maltose Neopentyl Glycol × 2 SODIUM ION × 2 (2S)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(hexanoyloxy)propyl hexanoate × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 CALCIUM ION × 2 ZINC ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DISP1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–1352； UniProt 172–1521

Sonic hedgehog protein

Mus musculus

UniProt Q62226

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Protein dispatched homolog 1 × 1 （Q3TDN0） CHOLESTEROL HEMISUCCINATE × 26 Lauryl Maltose Neopentyl Glycol × 2 SODIUM ION × 2 (2S)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(hexanoyloxy)propyl hexanoate × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 5 CALCIUM ION × 2 ZINC ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SHH_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–164； UniProt 26–189

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7rpk
Deposition date deposition_date	2021-08-03
Structure title title	Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog
Keywords keywords	RND transporter, Hedgehog binding, Sterol sensing domain, sodium binding, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7rpk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7rpk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7rpk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.14 Å
Rg (electron density)	37.97 Å
Total Rg	38.41 Å
Atom count	9968
Residues	1104
Excluded volume	183970 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7rpk__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Description description	Protein dispatched homolog 1
Molecular weight formula_weight	152071.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	10018

MARPFKFPRSYAALLADWPVVVLGMCTLLIVVCALVGVLVPELPDFSDPLLGFEPRGTTIGQRLVTWNNMMRNTGYKATLANYPYKYAEEQARSHRDDRWSDDHHERERREVDWNFQKDSFFCDVPSDGYSRVVFASAGGETLWNLPAIKSMCDVDNSRIRSHPQFSDLCQRTTAVSCCPSWTLGNYIAILNNRSSCQKIVERDVSHTLKLLRTCAKHYQNGTLGPDCWDKAARRKDQLKCTNVPRKCTKYNAVYQILHYLVDKDFMTPKTADYAVPALKYSMLFSPTEKGESMMNIYLDNFENWNSSDGITTVTGIEFGIKHSLFQDYLLMDTVYPAIAIAIVLLIMCVYTKSMFITLMTMFAIISSLIVSYFLYRVVFNFEFFPFMNLTALIILVGIGADDAFVLCDVWNYTKFDKPRAETSEAVSVTLQHAALSMFVTSFTTAAAFYANYVSNITAIRCFGVYAGTAILVNYVLMVTWLPAVIVLHERYLLNIFTCFRKPQPQAYDKSCWAVLCQKCRRVLFAVSEASRIFFEKVLPCIVIKFRYLWLIWFLALTVGGAYIVCVNPKMKLPSLELSEFQVFRSSHPFERYDAEFKKLFMFERVHHGEELHMPITVIWGVSPEDSGDPLNPKSKGELTLDSTFNIASPASQAWILHFCQKLRNQTFFHQTEQQDFTSCFIETFKQWMENQDCDEPALYPCCSHCSFPYKQEVFELCIKKAIMELDRSTGYHLNNKTPGPRFDINDTIRAVVLEFQSTFLFTLAYEKMQQFYKEVDSWISHELSSAPEGLSRGWFVSNLEFYDLQDSLSDGTLIAMGLSVAVAFSVMLLTTWNIIISLYAIVSIAGTIFVTVGSLVLLGWELNVLESVTISVAVGLSVDFAVHYGVAYRLAPDPDREGKVIFSLSRMGSAIAMAALTTFVAGAMMMPSTVLAYTQLGTFMMLVMCVSWAFATFFFQCLCRCLGPQGTCGQIPFPTKLQCSPFSHTLSARPGDRGPSKTHAASAYSVDARGQKSQLEHEFYELQPLASHSCTSSEKTTYEEPHTCSEFFNGQAKNLRMPVPAAYSSELTKSPSSEPGSALLQSCLEQDTVCHFSLNPRCNCRDAYTHLQYGLPEIHCQQMGDSLCHKCASTAGGFVQIQSSVAPLKASHQAAEGLLHPAQHMLPPGMQNSRPRNFFLHSVQHFQAQENLGRTSTHSTDERLPRTAELSPPPSDSRSTESFQRACCHPENNQRRLCKSRDPGDTEGSGGTKSKVSGLPNQTDKEEKQVEPSLLQTDETVNSEHLNHNESNFTFSHLPGEAGCRSCPNSPQSCRSIMRSKCGTEDCQTPNLEANVPAVPTHSDLSGESLLIKTL

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Sonic hedgehog protein
Molecular weight formula_weight	18732.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

GPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAE

Source Source

Source organism organism	Mus musculus
Common name common_name	Mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	CHOLESTEROL HEMISUCCINATE
Molecular weight formula_weight	486.7 kDa
Source method src_method	syn
Copy count entity_count	26

Entity 4 Entity 4 non-polymer

Description description	Lauryl Maltose Neopentyl Glycol
Molecular weight formula_weight	1005.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	(2S)-3-{[(S)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(hexanoyloxy)propyl hexanoate
Molecular weight formula_weight	411.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 8 Entity 8 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 9 Entity 9 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 11 Entity 11 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	42

▶

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	204786

Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein dispatched homolog 1

State in the Current Structure

Other States of the Same Protein in the Database

Sonic hedgehog protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rpk__assembly_1__model_1

7rpk__assembly_1__model_1 | I(q)

7rpk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 water

7. Citations (1)

Cryo-EM structure of murine Dispatched in complex with Sonic hedgehog

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein dispatched homolog 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Sonic hedgehog protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7rpk__assembly_1__model_1

7rpk__assembly_1__model_1 | I(q)

7rpk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (11)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

Entity 9 Entity 9 non-polymer

Entity 10 Entity 10 non-polymer

Entity 11 Entity 11 water

7. Citations (1)