SAXSdb — 7s6c

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion

Streptomyces lasalocidi

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	Fab 1B2 heavy chain × 2 Fab 1B2 light chain × 2 2'-MONOPHOSPHOADENOSINE-5'-DIPHOSPHATE × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B6ZK67_STRLS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 32–1641； UniProt 38–1647 Author chain B； PDBConstruct 32–1641； UniProt 38–1647 Author chain C； PDBConstruct 32–1641； UniProt 38–1647 Author chain D； PDBConstruct 32–1641； UniProt 38–1647

6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion

Streptomyces lasalocidi

UniProt Q03132

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 8	Fab 1B2 heavy chain × 2 Fab 1B2 light chain × 2 2'-MONOPHOSPHOADENOSINE-5'-DIPHOSPHATE × 1 4'-PHOSPHOPANTETHEINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ERYA2_SACER
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–31； UniProt 2–30 Author chain B； PDBConstruct 3–31； UniProt 2–30 Author chain C； PDBConstruct 3–31； UniProt 2–30 Author chain D； PDBConstruct 3–31； UniProt 2–30

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7s6c
Deposition date deposition_date	2021-09-13
Structure title title	CryoEM structure of modular PKS holo-Lsd14 stalled at the condensation step and bound to antibody fragment 1B2, composite structure
Keywords keywords	Modular polyketide synthase, ketosynthase, ketoreductase, acyl carrier protein, BIOSYNTHETIC PROTEIN; BIOSYNTHETIC PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7s6c__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7s6c__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7s6c__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	52.99 Å
Rg (electron density)	52.90 Å
Total Rg	52.95 Å
Atom count	47400
Residues	3190
Excluded volume	422060 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7s6c__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion
Molecular weight formula_weight	174085.7 kDa
EC 编号 ec_number	2.3.1.94
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	47400

MVTDSEKVAEYLRRATLDLRAARQRIRELESEPIAIIGMACRLPGGVDSPEGLWELVDSGTDAIAGFPLDRGWDVEGMYDPDAEAPGKTYVKEAGFLYDAGEFDAGFFGISPREAVSMDPQQRLMLEASWEAFERAGLDPARQRGTATGVFVGATATGYVSPAAEVPEGAEGFAITGNMTAVTSGRISYTLGLQGPAVTIDTACSSSLVALHLACQSLRQGECTTALAGGVTVMPTPTAFTEFSRQRGLAPDGRCKSFAAAADGTNWAEGVAVLVVERLSDARRNGHRVLAVVRGTAINQDGASNGLSAPNDLAQERVIRSALDNAGLTASDVDAVEAHGTGTTLGDPIEAQALLAAYGHERPAHRPLRVGSLKSNIGHAGPAAGVAGVIKMVMAMRHGVLPRSLHIDEPTPQVDWSSGAVTLLTEPVDWPDSDRPRRAGVSAFGISGTNAHVILEQAPTQDPQQPAPPVPAAPWLLSAKTPAALRAQARRLHTHLARHPHPDPTDIAHALATTRTPHEHRAALVTDDHGTRGPALAALAEGAPDACLISGTALSKGRTVFVFPGQGSQWTGMGRELLHTSPEFAAYIAECETALNDFVDWSLTDVLRGTEGAPGYDRVDVVQPALFAVMVSLARLWQHHGIHPDAVIGHSQGEIAAAHIAGALSLQDAARIVALRSQALLPLAGLGGMTSLALPHDQALQLIQPWGQDLSIASVNGPHSTVVSGTTHALDELHTTCDTQGVRARRIPVDYASHSAQVESIRDTVLQAATGINPQPTTIPLYSTVTGQPIDGTQLDADYWYTNLRHTVRFEETTRALLGSGHRHFIETTAHPVLALALEETIEATGSDARVTGTLRRDHGDLTQLHTALATAWTHGIDVDWTAVLGDRRTPFELPTYAFQRQRYWLEPGAGVGVPVGGTSAEARFWDAVEDEDLEALVAAIGADGDDASWAGVLPALAGWRRRQREQSALDDLRYKVTWKPTAVADGASATGTWLVVVPESLAGGGWPVVVARAVDQAGGRPVVLSVDAADGADRSRLGLRIHEALGEGPVPDAVVSLLALDPSALPGLPDVPQALASTAALVQALLDLGLEARLWCVTSGAVSVSGADGPSAPEQAAVWGFGRVAGLEHPHLWAGLVDLPPEADERTAARLVGVLAGAGGEDQVALRSSGVFVRRLVRAPASEVPAVRSWKPGGTVLVTGGTGGLGRQVARWLARGGADHLLLVSRRGVDAPGADELVDELTDLGARVTVAACDVADRDAVQRLLSEQVPSDAPLTAVIHTAAVLDDGVIDSLSPERMEQVLRVKVGGAVHLYELTRESDLSAFVLFSSFGSTFGLPGLGNYAPGNAALEALAEQWRAEGRPATAVGWGTWAGGGMADGGVGERGRTHGIHELEPALATAALEQALERDESSPVIIDIDWERFAVAFHAKRPTRGFELVPEAQAALEAADGGPGPDGGAGDPSELLDRLAALPDAERDRALLEVVRGNAASVMSHGAMRTATLEAVEPTRAFRDLGFDSLMAVELRNRIGAATGLRLAPTLVFDHPTPEAVVRHLRAELGLEGDGAPDPVFDELDGLERALSSYTPDTDTRVKITKRLESLLWEWTRSEADAPDPVDAADLAAVSDDEMFELIDRELGSALEHHHHHH

Source Source

Source organism organism	Streptomyces lasalocidi
NCBI taxonomy ID ncbi_taxonomy_id	324833
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Fab 1B2 heavy chain
Molecular weight formula_weight	26447.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,H

MAEVQLVQSGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTRGGTLFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCAALVPRGSAHHHHHHAADYKDDDDKA

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	Fab 1B2 light chain
Molecular weight formula_weight	25715.8 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,G

LFAIPLVVPFYSHSALDVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQSLQTPRLTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRGAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
Common name common_name	Human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 4 Entity 4 non-polymer

Description description	2'-MONOPHOSPHOADENOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	4'-PHOSPHOPANTETHEINE
Molecular weight formula_weight	358.3 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

Domain ID domain_id	7s6cA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	47 — Peroxisomal Thiolase; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Thiolase/Chalcone synthase

Domain ID domain_id	7s6cA02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	7s6cA03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	366 — Malonyl-Coenzyme A Acyl Carrier Protein; domain 2
Homologous superfamily homologous superfamily	10 — Malonyl-Coenzyme A Acyl Carrier Protein, domain 2

Domain ID domain_id	7s6cB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	47 — Peroxisomal Thiolase; Chain A, domain 1
Homologous superfamily homologous superfamily	10 — Thiolase/Chalcone synthase

Domain ID domain_id	7s6cB02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	3290 —

Domain ID domain_id	7s6cB03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	366 — Malonyl-Coenzyme A Acyl Carrier Protein; domain 2
Homologous superfamily homologous superfamily	10 — Malonyl-Coenzyme A Acyl Carrier Protein, domain 2

Domain ID domain_id	7s6cE01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7s6cE02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7s6cH01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	7s6cH02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	397539

CryoEM structure of modular PKS holo-Lsd14 stalled at the condensation step and bound to antibody fragment 1B2, composite structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion

State in the Current Structure

Other States of the Same Protein in the Database

6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s6c__assembly_1__model_1

7s6c__assembly_1__model_1 | I(q)

7s6c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

7. Citations (1)

CryoEM structure of modular PKS holo-Lsd14 stalled at the condensation step and bound to antibody fragment 1B2, composite structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

6-deoxyerythronolide-B synthase EryA2, modules 3 and 4, Lsd14 Polyketide synthase fusion

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7s6c__assembly_1__model_1

7s6c__assembly_1__model_1 | I(q)

7s6c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 10 domains

CATH v4.4 (10 domains)

7. Citations (1)