7scc

T-cylinder of Synechocystis PCC 6803 Phycobilisome, complex with OCP - local refinement

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin alpha chain

OrganismNot specified

UniProt Q01951

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Allophycocyanin beta chain × 12 （Q01952） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 2 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Orange carotenoid-binding protein × 4 （P74102） Phycobilisome rod-core linker polypeptide CpcG × 4 （P73093） PHYCOCYANOBILIN × 24 beta,beta-carotene-4,4'-dione × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHAA_SYNY3
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AA； PDBConstruct 1–161； UniProt 1–161 Author chain AC； PDBConstruct 1–161； UniProt 1–161 Author chain AE； PDBConstruct 1–161； UniProt 1–161 Author chain AH； PDBConstruct 1–161； UniProt 1–161 Author chain AJ； PDBConstruct 1–161； UniProt 1–161 Author chain AL； PDBConstruct 1–161； UniProt 1–161 Author chain AW； PDBConstruct 1–161； UniProt 1–161 Author chain AY； PDBConstruct 1–161； UniProt 1–161 Author chain BA； PDBConstruct 1–161； UniProt 1–161 Author chain BD； PDBConstruct 1–161； UniProt 1–161 Author chain BF； PDBConstruct 1–161； UniProt 1–161 Author chain BH； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin beta chain

OrganismNot specified

UniProt Q01952

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Allophycocyanin alpha chain × 12 （Q01951） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 2 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Orange carotenoid-binding protein × 4 （P74102） Phycobilisome rod-core linker polypeptide CpcG × 4 （P73093） PHYCOCYANOBILIN × 24 beta,beta-carotene-4,4'-dione × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCB_SYNY3
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain AB； PDBConstruct 1–161； UniProt 1–161 Author chain AD； PDBConstruct 1–161； UniProt 1–161 Author chain AF； PDBConstruct 1–161； UniProt 1–161 Author chain AI； PDBConstruct 1–161； UniProt 1–161 Author chain AK； PDBConstruct 1–161； UniProt 1–161 Author chain AM； PDBConstruct 1–161； UniProt 1–161 Author chain AX； PDBConstruct 1–161； UniProt 1–161 Author chain AZ； PDBConstruct 1–161； UniProt 1–161 Author chain BB； PDBConstruct 1–161； UniProt 1–161 Author chain BE； PDBConstruct 1–161； UniProt 1–161 Author chain BG； PDBConstruct 1–161； UniProt 1–161 Author chain BI； PDBConstruct 1–161； UniProt 1–161

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt Q01950

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Allophycocyanin alpha chain × 12 （Q01951） Allophycocyanin beta chain × 12 （Q01952） Phycobiliprotein ApcE × 2 （Q55544） Orange carotenoid-binding protein × 4 （P74102） Phycobilisome rod-core linker polypeptide CpcG × 4 （P73093） PHYCOCYANOBILIN × 24 beta,beta-carotene-4,4'-dione × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYC1_SYNY3
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AO； PDBConstruct 1–67； UniProt 1–67 Author chain BK； PDBConstruct 1–67； UniProt 1–67

Phycobiliprotein ApcE

OrganismNot specified

UniProt Q55544

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Allophycocyanin alpha chain × 12 （Q01951） Allophycocyanin beta chain × 12 （Q01952） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 2 （Q01950） Orange carotenoid-binding protein × 4 （P74102） Phycobilisome rod-core linker polypeptide CpcG × 4 （P73093） PHYCOCYANOBILIN × 24 beta,beta-carotene-4,4'-dione × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCE_SYNY3
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AQ； PDBConstruct 1–896； UniProt 1–896 Author chain BM； PDBConstruct 1–896； UniProt 1–896

Orange carotenoid-binding protein

Synechocystis sp. PCC 6803 substr. Kazusa

UniProt P74102

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Allophycocyanin alpha chain × 12 （Q01951） Allophycocyanin beta chain × 12 （Q01952） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 2 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Phycobilisome rod-core linker polypeptide CpcG × 4 （P73093） PHYCOCYANOBILIN × 24 beta,beta-carotene-4,4'-dione × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	OCP_SYNY3
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AS； PDBConstruct 1–317； UniProt 1–317 Author chain AT； PDBConstruct 1–317； UniProt 1–317 Author chain BO； PDBConstruct 1–317； UniProt 1–317 Author chain BP； PDBConstruct 1–317； UniProt 1–317

Phycobilisome rod-core linker polypeptide CpcG

OrganismNot specified

UniProt P73093

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 36	Allophycocyanin alpha chain × 12 （Q01951） Allophycocyanin beta chain × 12 （Q01952） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 2 （Q01950） Phycobiliprotein ApcE × 2 （Q55544） Orange carotenoid-binding protein × 4 （P74102） PHYCOCYANOBILIN × 24 beta,beta-carotene-4,4'-dione × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYG_SYNY3
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AU； PDBConstruct 1–249； UniProt 1–249 Author chain AV； PDBConstruct 1–249； UniProt 1–249 Author chain BQ； PDBConstruct 1–249； UniProt 1–249 Author chain BR； PDBConstruct 1–249； UniProt 1–249

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7scc
Deposition date deposition_date	2021-09-27
Structure title title	T-cylinder of Synechocystis PCC 6803 Phycobilisome, complex with OCP - local refinement
Keywords keywords	Complex, light harvesting, pigment, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7scc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7scc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7scc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	55.70 Å
Rg (electron density)	55.32 Å
Total Rg	55.51 Å
Atom count	43008
Residues	5474
Excluded volume	767810 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7scc__assembly_1__model_1`	36-meric （36）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	Allophycocyanin alpha chain
Molecular weight formula_weight	17429.8 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AA,AC,AE,AH,AJ,AL,AW,AY,BA,BD,BF,BH
Atom count atom_count	43008

MSIVTKSIVNADAEARYLSPGELDRIKAFVTGGAARLRIAETLTGSRETIVKQAGDRLFQKRPDIVSPGGNAYGEEMTATCLRDMDYYLRLVTYGVVSGDVTPIEEIGLVGVREMYRSLGTPIEAVAQSVREMKEVASGLMSSDDAAEASAYFDFVIGKMS

Entity 2 Entity 2 polymer

Description description	Allophycocyanin beta chain
Molecular weight formula_weight	17231.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AB,AD,AF,AI,AK,AM,AX,AZ,BB,BE,BG,BI

MQDAITAVINSADVQGKYLDGAAMDKLKSYFASGELRVRAASVISANAATIVKEAVAKSLLYSDVTRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGDASILDERVLNGLKETYNSLGVPISSTVQAIQAIKEVTASLVGADAGKEMGVYLDYICSGLS

Entity 3 Entity 3 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7817.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AO,BK

MRMFRITACVPSQTRIRTQRELQNTYFTKLVPYDNWFREQQRIMKMGGKIVKVELATGRPGTNAGLA

Entity 4 Entity 4 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	100412.7 kDa
EC 编号 ec_number	4.-.-.-
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AQ,BM

MSVKASGGSSLARPQLYQTVPVSAISQAEQQDRFLEGSELNELTAYFQSGALRLEIAETLTQNADLIVSRAANRIFTGGSPLSYLEKPVERQPALVGASSDSRNGSVTYAESNGSGGLFGGLRSVFSSTGPIPPGFRPINIARYGPSNMQKSLRDMSWFLRYTTYAIVAGDPNIIVVNTRGLKEVIENACSIDATIVAIQEMRAASADYFRNNAQAKEIVLQYFDILLSEFKAPTPANKVRQGPSNDIQGLELPQSYFNAAAKRQKYAMKPGLSALEKNAVIKAAYRQIFERDITKAYSQSISYLESQVRNGDISMKEFVRRLAKSPLYRKQFFEPFINSRALELAFRHILGRGPSSREEVQKYFSIVSSGGLPALVDALVDSQEYADYFGEETVPYLRGLGVEAQECRNWGMQQDLFSYSAPFRKVPQFITTFAQYDRPLPDQHVYGSGNDPLEIQFGAIFPKETRNPSKRPAPFNKDTKRILIHRGPAVNNQVGNPSAVGEFPGSLGAKVFRLNGGLPGAKVGKNTGTSVKFGESSTQALIRAAYRQVFGRDLYEGQRLSVAEIQLENGDISVREFIKRLAKSELFLKLYWAPHYVCKAIEYMHRRLLGRPTYGRQEMNQYFDIASKQGFYAVVEAMIDSKEYSDAFGEDTVPYERYLTPGGLQMRSARVGSLREDIGQRVDKEVTPRFVELGQVSAIRTEPEIAYRSNQGVTRQRQQTKVFKLVSTYDKVAVKNAIRAAYRQVFERDLEPYIINSEFTALESKLSNNEINVKEFIEGLGTSELYMKEFYAPYPNTKVIEMGTKHFLGRAPLNQKEIQQYNQILASQGLKAFIGAMVNGMEYLQTFGEDTVPYRRFPTLPAANFPNTERLYNKLTKQDKELVVPSFTPVVKVGG

Entity 5 Entity 5 polymer

Description description	Orange carotenoid-binding protein
Molecular weight formula_weight	34684.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS,AT,BO,BP

MPFTIDSARGIFPNTLAADVVPATIARFSQLNAEDQLALIWFAYLEMGKTLTIAAPGAASMQLAENALKEIQAMGPLQQTQAMCDLANRADTPLCRTYASWSPNIKLGFWYRLGELMEQGFVAPIPAGYQLSANANAVLATIQGLESGQQITVLRNAVVDMGFTAGKDGKRIAEPVVPPQDTASRTKVSIEGVTNATVLNYMDNLNANDFDTLIELFTSDGALQPPFQRPIVGKENVLRFFREECQNLKLIPERGVTEPAEDGFTQIKVTGKVQTPWFGGNVGMNIAWRFLLNPEGKIFFVAIDLLASPKELLNFAR

Source Source

Source organism organism	Synechocystis sp. PCC 6803 substr. Kazusa
NCBI taxonomy ID ncbi_taxonomy_id	1111708
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Phycobilisome rod-core linker polypeptide CpcG
Molecular weight formula_weight	28938.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AU,AV,BQ,BR

MALPLLNYAPKSQNVRVEGYEIGSEEKPVVFTTENILSSSDMDNLIEAAYRQIFFHAFKWDREKVLESQLRNGQITVRDFVRGLLLSNTFRNSFYEKNSNYRFVEHCVQKILGRDVYSEREKIAWSIVVATKGYQGLIDDLLNSDEYLNNFGYDTVPYQRRRNLPGREAGELPFNIKSPRYDAYHRRQLGFPQIVWQNEVRRFIPQEKKLTAGNPMNFLGMARSINPAANTIPKVSAQNINIEASVPRR

Entity 7 Entity 7 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	24

Entity 8 Entity 8 non-polymer

Description description	beta,beta-carotene-4,4'-dione
Molecular weight formula_weight	564.8 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	176804

T-cylinder of Synechocystis PCC 6803 Phycobilisome, complex with OCP - local refinement

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Orange carotenoid-binding protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod-core linker polypeptide CpcG

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7scc__assembly_1__model_1

7scc__assembly_1__model_1 | I(q)

7scc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 non-polymer

7. Citations (1)