7srv

Metal dependent activation of Plasmodium falciparum M17 aminopeptidase (inactive form), spacegroup P22121

Method: X-RAY DIFFRACTION D_max: 139.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

M17 leucyl aminopeptidase

Plasmodium falciparum

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 85–605 Chain B； UniProt 85–605 Chain C； UniProt 85–605 Chain D； UniProt 85–605 Chain E； UniProt 85–605 Chain F； UniProt 85–605	Not recorded	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 ACT ACETATE ION × 8 CA CALCIUM ION × 12 EDO 1,2-ETHANEDIOL × 6 PO4 PHOSPHATE ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；293 K；20 % PEG3350, 0.2 M calcium acetate	Resolution 2.03 Å R-free 0.219

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7SRV	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3KQX Structure of a protease 1 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Fragment：residues 84-605 Chain B 84–605（522 aa） Fragment：residues 84-605 Chain C 84–605（522 aa） Fragment：residues 84-605 Chain D 84–605（522 aa） Fragment：residues 84-605 Chain E 84–605（522 aa） Fragment：residues 84-605 Chain F 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	ZN ZINC ION × 6 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 11 1PE PENTAETHYLENE GLYCOL × 24 2PE NONAETHYLENE GLYCOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSO4, 1mM TCEP, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.01 Å R-free 0.232
3KQX Structure of a protease 1 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Fragment：residues 84-605 Chain H 84–605（522 aa） Fragment：residues 84-605 Chain I 84–605（522 aa） Fragment：residues 84-605 Chain J 84–605（522 aa） Fragment：residues 84-605 Chain K 84–605（522 aa） Fragment：residues 84-605 Chain L 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	ZN ZINC ION × 6 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 5 1PE PENTAETHYLENE GLYCOL × 30 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSO4, 1mM TCEP, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.01 Å R-free 0.232
3KQZ Structure of a protease 2 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Fragment：residues 84-605 Chain B 84–605（522 aa） Fragment：residues 84-605 Chain C 84–605（522 aa） Fragment：residues 84-605 Chain D 84–605（522 aa） Fragment：residues 84-605 Chain E 84–605（522 aa） Fragment：residues 84-605 Chain F 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 SO4 SULFATE ION × 16 1PE PENTAETHYLENE GLYCOL × 24 2PE NONAETHYLENE GLYCOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSO4, 1mM TCEP, 1mM ZnCl2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.39 Å R-free 0.242
3KQZ Structure of a protease 2 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Fragment：residues 84-605 Chain H 84–605（522 aa） Fragment：residues 84-605 Chain I 84–605（522 aa） Fragment：residues 84-605 Chain J 84–605（522 aa） Fragment：residues 84-605 Chain K 84–605（522 aa） Fragment：residues 84-605 Chain L 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 SO4 SULFATE ION × 11 1PE PENTAETHYLENE GLYCOL × 29 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSO4, 1mM TCEP, 1mM ZnCl2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.39 Å R-free 0.242
3KR4 Structure of a protease 3 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Fragment：residues 84-605 Chain B 84–605（522 aa） Fragment：residues 84-605 Chain C 84–605（522 aa） Fragment：residues 84-605 Chain D 84–605（522 aa） Fragment：residues 84-605 Chain E 84–605（522 aa） Fragment：residues 84-605 Chain F 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	CO3 CARBONATE ION × 6 ZN ZINC ION × 6 BES 2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METHYL-PENTANOIC ACID × 6 MG MAGNESIUM ION × 6 SO4 SULFATE ION × 8 1PE PENTAETHYLENE GLYCOL × 17	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSo4, 1mM TCEP, 1mM MgCl2, 1mM Bestatin, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.242
3KR4 Structure of a protease 3 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Fragment：residues 84-605 Chain H 84–605（522 aa） Fragment：residues 84-605 Chain I 84–605（522 aa） Fragment：residues 84-605 Chain J 84–605（522 aa） Fragment：residues 84-605 Chain K 84–605（522 aa） Fragment：residues 84-605 Chain L 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	CO3 CARBONATE ION × 6 ZN ZINC ION × 6 BES 2-(3-AMINO-2-HYDROXY-4-PHENYL-BUTYRYLAMINO)-4-METHYL-PENTANOIC ACID × 6 MG MAGNESIUM ION × 6 SO4 SULFATE ION × 6 1PE PENTAETHYLENE GLYCOL × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSo4, 1mM TCEP, 1mM MgCl2, 1mM Bestatin, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.242
3KR5 Structure of a protease 4 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Fragment：residues 84-605 Chain B 84–605（522 aa） Fragment：residues 84-605 Chain C 84–605（522 aa） Fragment：residues 84-605 Chain D 84–605（522 aa） Fragment：residues 84-605 Chain E 84–605（522 aa） Fragment：residues 84-605 Chain F 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 BEY (2S)-3-[(R)-[(1S)-1-amino-3-phenylpropyl](hydroxy)phosphoryl]-2-benzylpropanoic acid × 6 SO4 SULFATE ION × 8 1PE PENTAETHYLENE GLYCOL × 17	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSO4, 1mM TCEP, 1mM ZnCl2, 1mM Co4/BEY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.56 Å R-free 0.278
3KR5 Structure of a protease 4 Deposited 2009-11-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Fragment：residues 84-605 Chain H 84–605（522 aa） Fragment：residues 84-605 Chain I 84–605（522 aa） Fragment：residues 84-605 Chain J 84–605（522 aa） Fragment：residues 84-605 Chain K 84–605（522 aa） Fragment：residues 84-605 Chain L 84–605（522 aa） Fragment：residues 84-605	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 BEY (2S)-3-[(R)-[(1S)-1-amino-3-phenylpropyl](hydroxy)phosphoryl]-2-benzylpropanoic acid × 6 SO4 SULFATE ION × 7 1PE PENTAETHYLENE GLYCOL × 20	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris pH 8.5, 0.2M LiSO4, 1mM TCEP, 1mM ZnCl2, 1mM Co4/BEY, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.56 Å R-free 0.278
3T8W A bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases Deposited 2011-08-01	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Fragment：UNP residues 84-605 Chain B 84–605（522 aa） Fragment：UNP residues 84-605 Chain C 84–605（522 aa） Fragment：UNP residues 84-605 Chain D 84–605（522 aa） Fragment：UNP residues 84-605 Chain E 84–605（522 aa） Fragment：UNP residues 84-605 Chain F 84–605（522 aa） Fragment：UNP residues 84-605	Not recorded	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 DGZ N-((2R,3S,6S,18S,21S)-2-amino-18-(4-benzoylbenzyl)-21-carbamoyl-3-hydroxy-6-(naphthalen-2-ylmethyl)-4,7,16,19-tetraoxo-1-phenyl-11,14-dioxa-5,8,17,20-tetraazapentacosan-25-yl)hex-5-ynamide × 6 SO4 SULFATE ION × 12 1PE PENTAETHYLENE GLYCOL × 14 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40%(v/v) PEG400, 0.1M Tris, 0.2M LiSO4, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.200
3T8W A bestatin-based chemical biology strategy reveals distinct roles for malaria M1- and M17-family aminopeptidases Deposited 2011-08-01	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Fragment：UNP residues 84-605 Chain H 84–605（522 aa） Fragment：UNP residues 84-605 Chain I 84–605（522 aa） Fragment：UNP residues 84-605 Chain J 84–605（522 aa） Fragment：UNP residues 84-605 Chain K 84–605（522 aa） Fragment：UNP residues 84-605 Chain L 84–605（522 aa） Fragment：UNP residues 84-605	Not recorded	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 DGZ N-((2R,3S,6S,18S,21S)-2-amino-18-(4-benzoylbenzyl)-21-carbamoyl-3-hydroxy-6-(naphthalen-2-ylmethyl)-4,7,16,19-tetraoxo-1-phenyl-11,14-dioxa-5,8,17,20-tetraazapentacosan-25-yl)hex-5-ynamide × 6 SO4 SULFATE ION × 17 1PE PENTAETHYLENE GLYCOL × 19 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40%(v/v) PEG400, 0.1M Tris, 0.2M LiSO4, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.200
4K3N Phosphonic Arginine Mimetics as Inhibitors of the M17 Aminopeptidases from Plasmodium falciparum Deposited 2013-04-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Fragment：unp residues 84-605 Chain B 84–605（522 aa） Fragment：unp residues 84-605 Chain C 84–605（522 aa） Fragment：unp residues 84-605 Chain D 84–605（522 aa） Fragment：unp residues 84-605 Chain E 84–605（522 aa） Fragment：unp residues 84-605 Chain F 84–605（522 aa） Fragment：unp residues 84-605	Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 1OT {(R)-amino[4-(1H-pyrazol-1-yl)phenyl]methyl}phosphonic acid × 6 SO4 SULFATE ION × 11 1PE PENTAETHYLENE GLYCOL × 15 2PE NONAETHYLENE GLYCOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris, 0.2M LiSO4, 1mM TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.240
4K3N Phosphonic Arginine Mimetics as Inhibitors of the M17 Aminopeptidases from Plasmodium falciparum Deposited 2013-04-11	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Fragment：unp residues 84-605 Chain H 84–605（522 aa） Fragment：unp residues 84-605 Chain I 84–605（522 aa） Fragment：unp residues 84-605 Chain J 84–605（522 aa） Fragment：unp residues 84-605 Chain K 84–605（522 aa） Fragment：unp residues 84-605 Chain L 84–605（522 aa） Fragment：unp residues 84-605	Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 1OT {(R)-amino[4-(1H-pyrazol-1-yl)phenyl]methyl}phosphonic acid × 6 SO4 SULFATE ION × 10 1PE PENTAETHYLENE GLYCOL × 19 2PE NONAETHYLENE GLYCOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% PEG 400, 0.1M Tris, 0.2M LiSO4, 1mM TCEP, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.00 Å R-free 0.240
4R6T Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor Deposited 2014-08-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Chain B 84–605（522 aa） Chain C 84–605（522 aa） Chain D 84–605（522 aa） Chain E 84–605（522 aa） Chain F 84–605（522 aa）	Not recorded	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 12 R5T tert-butyl {(1S)-2-(hydroxyamino)-2-oxo-1-[4-(1H-pyrazol-1-yl)phenyl]ethyl}carbamate × 6 1PE PENTAETHYLENE GLYCOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4, 1 mM TCEP, vapor diffusion, hanging drop, temperature 298K	Resolution 2.60 Å R-free 0.269
4R6T Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor Deposited 2014-08-26	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Chain H 84–605（522 aa） Chain I 84–605（522 aa） Chain J 84–605（522 aa） Chain K 84–605（522 aa） Chain L 84–605（522 aa）	Not recorded	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 11 R5T tert-butyl {(1S)-2-(hydroxyamino)-2-oxo-1-[4-(1H-pyrazol-1-yl)phenyl]ethyl}carbamate × 6 1PE PENTAETHYLENE GLYCOL × 8 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4, 1 mM TCEP, vapor diffusion, hanging drop, temperature 298K	Resolution 2.60 Å R-free 0.269
4R7M Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor Deposited 2014-08-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Fragment：unp residues 84-605 Chain B 84–605（522 aa） Fragment：unp residues 84-605 Chain C 84–605（522 aa） Fragment：unp residues 84-605 Chain D 84–605（522 aa） Fragment：unp residues 84-605 Chain E 84–605（522 aa） Fragment：unp residues 84-605 Chain F 84–605（522 aa） Fragment：unp residues 84-605	Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 1PE PENTAETHYLENE GLYCOL × 7 3MW 4-amino-N-{(1R)-2-(hydroxyamino)-2-oxo-1-[4-(1H-pyrazol-1-yl)phenyl]ethyl}benzamide × 6 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4, 1 mM TCEP, vapor diffusion, hanging drop, temperature 298K	Resolution 2.85 Å R-free 0.291
4R7M Structure of the m17 leucyl aminopeptidase from malaria complexed with a hydroxamic acid-based inhibitor Deposited 2014-08-28	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Fragment：unp residues 84-605 Chain H 84–605（522 aa） Fragment：unp residues 84-605 Chain I 84–605（522 aa） Fragment：unp residues 84-605 Chain J 84–605（522 aa） Fragment：unp residues 84-605 Chain K 84–605（522 aa） Fragment：unp residues 84-605 Chain L 84–605（522 aa） Fragment：unp residues 84-605	Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N Mutation：D152N, D515N, D516N	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 1PE PENTAETHYLENE GLYCOL × 4 3MW 4-amino-N-{(1R)-2-(hydroxyamino)-2-oxo-1-[4-(1H-pyrazol-1-yl)phenyl]ethyl}benzamide × 6 SO4 SULFATE ION × 5 DMS DIMETHYL SULFOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4, 1 mM TCEP, vapor diffusion, hanging drop, temperature 298K	Resolution 2.85 Å R-free 0.291
4X2T X-ray crystal structure of the orally available aminopeptidase inhibitor, Tosedostat, bound to the M17 Leucyl Aminopeptidase from P. falciparum Deposited 2014-11-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain B 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain C 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain D 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain E 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain F 85–603（519 aa） Fragment：UNP residues 85 to 603	Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q	ZN ZINC ION × 12 TOD (2S)-({(2R)-2-[(1S)-1-hydroxy-2-(hydroxyamino)-2-oxoethyl]-4-methylpentanoyl}amino)(phenyl)ethanoic acid × 5 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 8 1PE PENTAETHYLENE GLYCOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；298 K；35% (v/v) PEG 400, 0.1 M Tris pH 8.6, 0.2 M Li2SO4	Resolution 2.73 Å R-free 0.274
4X2T X-ray crystal structure of the orally available aminopeptidase inhibitor, Tosedostat, bound to the M17 Leucyl Aminopeptidase from P. falciparum Deposited 2014-11-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain H 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain I 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain J 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain K 85–603（519 aa） Fragment：UNP residues 85 to 603 Chain L 85–603（519 aa） Fragment：UNP residues 85 to 603	Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q Mutation：N152Q, N515Q, N545Q	ZN ZINC ION × 12 TOD (2S)-({(2R)-2-[(1S)-1-hydroxy-2-(hydroxyamino)-2-oxoethyl]-4-methylpentanoyl}amino)(phenyl)ethanoic acid × 6 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 5 1PE PENTAETHYLENE GLYCOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.6；298 K；35% (v/v) PEG 400, 0.1 M Tris pH 8.6, 0.2 M Li2SO4	Resolution 2.73 Å R-free 0.274
7RIE Plasmodium falciparum M17 in complex with inhibitor MIPS2571 Deposited 2021-07-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–605（521 aa） Chain B 85–605（521 aa） Chain C 85–605（521 aa） Chain D 85–605（521 aa） Chain E 85–605（521 aa） Chain F 85–605（521 aa）	Not recorded	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 1PE PENTAETHYLENE GLYCOL × 5 5IF N-{(1R)-2-(hydroxyamino)-1-[4'-(hydroxymethyl)[1,1'-biphenyl]-4-yl]-2-oxoethyl}-2,2-dimethylpropanamide × 6 SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, 0.2M LiSO4, 0.1M Tris pH 7.5 to 8.8	Resolution 2.49 Å R-free 0.229
7RIE Plasmodium falciparum M17 in complex with inhibitor MIPS2571 Deposited 2021-07-19	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 85–605（521 aa） Chain H 85–605（521 aa） Chain I 85–605（521 aa） Chain J 85–605（521 aa） Chain K 85–605（521 aa） Chain L 85–605（521 aa）	Not recorded	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 1PE PENTAETHYLENE GLYCOL × 4 5IF N-{(1R)-2-(hydroxyamino)-1-[4'-(hydroxymethyl)[1,1'-biphenyl]-4-yl]-2-oxoethyl}-2,2-dimethylpropanamide × 6 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；PEG400, 0.2M LiSO4, 0.1M Tris pH 7.5 to 8.8	Resolution 2.49 Å R-free 0.229
7T3V Metal dependent activation of Plasmodium falciparum M17 aminopeptidase, spacegroup P22121 after crystals soaked with Zn2+ Deposited 2021-12-08	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–605（521 aa） Chain B 85–605（521 aa） Chain C 85–605（521 aa） Chain D 85–605（521 aa） Chain E 85–605（521 aa） Chain F 85–605（521 aa）	Not recorded	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 MPD (4S)-2-METHYL-2,4-PENTANEDIOL × 2 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；50 mM HEPES pH 8.0, 150 mM NaCl	Resolution 2.30 Å R-free 0.264
8EZ4 Plasmodium falciparum M17 in complex with inhibitor 9aa Deposited 2022-10-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–605（521 aa） Chain B 85–605（521 aa） Chain C 85–605（521 aa） Chain D 85–605（521 aa） Chain E 85–605（521 aa） Chain F 85–605（521 aa）	Not recorded	X10 N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluoro[1,1'-biphenyl]-4-yl)ethyl]-N~2~-phenylglycinamide × 6 SO4 SULFATE ION × 7 1PE PENTAETHYLENE GLYCOL × 16 CO3 CARBONATE ION × 6 ZN ZINC ION × 12 NA SODIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；30-40% PEG400, 0.1 M Tris pH 7.5-8.5, 0.2 M Li2SO4	Resolution 1.89 Å R-free 0.216
8EZ4 Plasmodium falciparum M17 in complex with inhibitor 9aa Deposited 2022-10-31	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 85–605（521 aa） Chain H 85–605（521 aa） Chain I 85–605（521 aa） Chain J 85–605（521 aa） Chain K 85–605（521 aa） Chain L 85–605（521 aa）	Not recorded	X10 N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluoro[1,1'-biphenyl]-4-yl)ethyl]-N~2~-phenylglycinamide × 6 SO4 SULFATE ION × 6 1PE PENTAETHYLENE GLYCOL × 14 CO3 CARBONATE ION × 6 ZN ZINC ION × 12 NA SODIUM ION × 5 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；30-40% PEG400, 0.1 M Tris pH 7.5-8.5, 0.2 M Li2SO4	Resolution 1.89 Å R-free 0.216
8SVM Plasmodium falciparum M17 aminopeptidase bound to MMV1557817 Deposited 2023-05-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Chain B 84–605（522 aa） Chain C 84–605（522 aa） Chain D 84–605（522 aa） Chain E 84–605（522 aa） Chain F 84–605（522 aa）	Not recorded	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 WRC N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluoro[1,1'-biphenyl]-4-yl)ethyl]-3,3-dimethylbutanamide × 6 1PE PENTAETHYLENE GLYCOL × 15 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4	Resolution 2.30 Å R-free 0.252
8SVM Plasmodium falciparum M17 aminopeptidase bound to MMV1557817 Deposited 2023-05-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Chain H 84–605（522 aa） Chain I 84–605（522 aa） Chain J 84–605（522 aa） Chain K 84–605（522 aa） Chain L 84–605（522 aa）	Not recorded	CO3 CARBONATE ION × 6 ZN ZINC ION × 12 WRC N-[(1R)-2-(hydroxyamino)-2-oxo-1-(3',4',5'-trifluoro[1,1'-biphenyl]-4-yl)ethyl]-3,3-dimethylbutanamide × 6 1PE PENTAETHYLENE GLYCOL × 13 SO4 SULFATE ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4	Resolution 2.30 Å R-free 0.252
8SW9 Plasmodium falciparum M17 (A460S) mutant Deposited 2023-05-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 84–605（522 aa） Chain B 84–605（522 aa） Chain C 84–605（522 aa） Chain D 84–605（522 aa） Chain E 84–605（522 aa） Chain F 84–605（522 aa）	Not recorded	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 8 1PE PENTAETHYLENE GLYCOL × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4	Resolution 2.60 Å R-free 0.281
8SW9 Plasmodium falciparum M17 (A460S) mutant Deposited 2023-05-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 84–605（522 aa） Chain H 84–605（522 aa） Chain I 84–605（522 aa） Chain J 84–605（522 aa） Chain K 84–605（522 aa） Chain L 84–605（522 aa）	Not recorded	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 SO4 SULFATE ION × 9 1PE PENTAETHYLENE GLYCOL × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；298 K；40% (v/v) PEG 400, 0.1 M Tris pH 8.5, 0.2 M Li2SO4	Resolution 2.60 Å R-free 0.281
9YC0 Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3ab (MIPS3413) Deposited 2025-09-17	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–605（521 aa） Chain B 85–605（521 aa） Chain C 85–605（521 aa） Chain D 85–605（521 aa） Chain E 85–605（521 aa） Chain F 85–605（521 aa）	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 PEG DI(HYDROXYETHYL)ETHER × 20 SO4 SULFATE ION × 29 A1CT4 N-[(1R)-1-(1,3-benzothiazol-5-yl)-2-(hydroxyamino)-2-oxoethyl]-3,3-dimethylbutanamide × 6 1PE PENTAETHYLENE GLYCOL × 16 DMS DIMETHYL SULFOXIDE × 7 2PE NONAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；30-40% PEG400, 0.1 M Tris pH 7.5-8.5, 0.2 M Li2SO4	Resolution 2.37 Å R-free 0.271
9YC0 Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3ab (MIPS3413) Deposited 2025-09-17	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 85–605（521 aa） Chain H 85–605（521 aa） Chain I 85–605（521 aa） Chain J 85–605（521 aa） Chain K 85–605（521 aa） Chain L 85–605（521 aa）	Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q Mutation：N152Q, N515Q, N546Q	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 PEG DI(HYDROXYETHYL)ETHER × 16 SO4 SULFATE ION × 30 A1CT4 N-[(1R)-1-(1,3-benzothiazol-5-yl)-2-(hydroxyamino)-2-oxoethyl]-3,3-dimethylbutanamide × 5 1PE PENTAETHYLENE GLYCOL × 21 DMS DIMETHYL SULFOXIDE × 6 2PE NONAETHYLENE GLYCOL × 1 A1CT5 N-[(1S)-1-(1,3-benzothiazol-5-yl)-2-(hydroxyamino)-2-oxoethyl]-3,3-dimethylbutanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；30-40% PEG400, 0.1 M Tris pH 7.5-8.5, 0.2 M Li2SO4	Resolution 2.37 Å R-free 0.271
9YC7 Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3k (MIPS3415) Deposited 2025-09-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 85–605（521 aa） Chain B 85–605（521 aa） Chain C 85–605（521 aa） Chain D 85–605（521 aa） Chain E 85–605（521 aa） Chain F 85–605（521 aa）	Not recorded	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 PEG DI(HYDROXYETHYL)ETHER × 23 DMS DIMETHYL SULFOXIDE × 10 SO4 SULFATE ION × 12 GOL GLYCEROL × 1 A1CTH N-[(1R)-2-(hydroxyamino)-2-oxo-1-(quinolin-7-yl)ethyl]-3,3-dimethylbutanamide × 1 1PE PENTAETHYLENE GLYCOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；30-40% PEG400, 0.1 M Tris pH 7.5-8.5, 0.2 M Li2SO4	Resolution 2.37 Å R-free 0.287
9YC7 Plasmodium falciparum M17 aminopeptidase (PfA-M17) bound to inhibitor 3k (MIPS3415) Deposited 2025-09-18	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain G 85–605（521 aa） Chain H 85–605（521 aa） Chain I 85–605（521 aa） Chain J 85–605（521 aa） Chain K 85–605（521 aa） Chain L 85–605（521 aa）	Not recorded	ZN ZINC ION × 12 CO3 CARBONATE ION × 6 PEG DI(HYDROXYETHYL)ETHER × 20 DMS DIMETHYL SULFOXIDE × 9 SO4 SULFATE ION × 11 GOL GLYCEROL × 1 1PE PENTAETHYLENE GLYCOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；30-40% PEG400, 0.1 M Tris pH 7.5-8.5, 0.2 M Li2SO4	Resolution 2.37 Å R-free 0.287

16 other PDB entries and 31 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q8IL11_PLAF7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–521； UniProt 85–605 Author chain B； PDBConstruct 1–521； UniProt 85–605 Author chain C； PDBConstruct 1–521； UniProt 85–605 Author chain D； PDBConstruct 1–521； UniProt 85–605 Author chain E； PDBConstruct 1–521； UniProt 85–605 Author chain F； PDBConstruct 1–521； UniProt 85–605

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7srv
Deposition date deposition_date	2021-11-08
Structure title title	Metal dependent activation of Plasmodium falciparum M17 aminopeptidase (inactive form), spacegroup P22121
Keywords keywords	Malaria, enzyme, metallo aminopeptidase, PEPTIDE BINDING PROTEIN; PEPTIDE BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	43.83 Å
Radius of gyration Rg (electron density) rg_electron	43.09 Å
Forward intensity I(0) i0	1558140000.00
Molecular weight molecular_weight	335600.0 kDa
Excluded volume excluded_volume	422550 Å³
Envelope volume envelope_volume	535720 Å³
Hydration-shell volume shell_volume	98031 Å³
Envelope diameter envelope_diameter	138.3 Å
Shell Rg shell_rg	52.18 Å
Envelope Rg envelope_rg	42.41 Å
Shape Rg shape_rg	43.14 Å
Total Rg total_rg	43.26 Å
Total atoms total_atoms	23580
Residues n_residues	3082
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	139.3 Å
Rg (real space) rg_real	43.58 Å
Rg uncertainty (real space) rg_real_error	0.62 Å
I(0) (real space) i0_real	1.5580e+09
I(0) uncertainty (real space) i0_real_error	2.5320e+07
Rg (reciprocal space) rg_reciprocal	43.83 Å
I(0) (reciprocal space) i0_reciprocal	1559000000.0000
Solution quality estimate total_estimate	0.8775
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	58.0 Å
Skewness Skewness skewness	0.157
Kurtosis Kurtosis kurtosis	-0.383
Angular range angular_range	— – 0.1800 Å⁻¹
Current regularization parameter α current_alpha	0.0004
Highest regularization parameter α highest_alpha	396900000.0000
Real-space data points n_real_points	37
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.841; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.968; Smooth: 0.912

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	M17 leucyl aminopeptidase
Molecular weight formula_weight	58577.8 kDa
EC 编号 ec_number	3.4.11.1
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	25540

ASEVPQVVSLDPTSIPIEYNTPIHDIKVQVYDIKGGCNVEEGLTIFLVNNPGKENGPVKISSKVNDKQVSEFLKDENMEKFNVKLGTSKHFYMFNDNKNSVAVGYVGCGSVADLSEADMKRVVLSLVTMLHDNKLSKLTVVFEINVDKNLFRFFLETLFYEYMTDERFKSTDKNVNMEYIKHLGVYINNADTYKEEVEKARVYYFGTYYASQLIAAPSNYCNPVSLSNAAVELAQKLNLEYKILGVKELEELKMGAYLSVGKGSMYPNKFIHLTYKSKGDVKKKIALVGKGITFDSGGYNLKAAPGSMIDLMKFDMSGCAAVLGCAYCVGTLKPENVEIHFLSAVCENMVSKNSYRPGDIITASNGKTIEVGNTDAEGRLTLADALVYAEKLGVDYIVDIATLTGAMLYSLGTSYAGVFGNNEELINKILQSSKTSNEPVWWLPIINEYRATLNSKYADINQISSSVKASSIVASLFLKEFVQNTAWAHIDIAGVSWNFKARKPKGFGVRLLTEFVLNDALHHHHHH

来源 Source

来源生物 organism	Plasmodium falciparum
NCBI Class编号 ncbi_taxonomy_id	5833
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 3 Entity 3 non-polymer

Description description	CARBONATE ION
Molecular weight formula_weight	60.0 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 6 Entity 6 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 7 Entity 7 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 8 Entity 8 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 9 Entity 9 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1906

▼

7. Fold Classification (SCOP + CATH) 12 domains

CATH v4.4 (12 domains)

Domain ID domain_id	7srvA01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	220 — Leucine Aminopeptidase, subunit E; domain 1
Homologous superfamily homologous superfamily	10 — Leucine Aminopeptidase, subunit E, domain 1

Domain ID domain_id	7srvA02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	630 — Aminopeptidase
Homologous superfamily homologous superfamily	10 — Zn peptidases

Domain ID domain_id	7srvB01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	220 — Leucine Aminopeptidase, subunit E; domain 1
Homologous superfamily homologous superfamily	10 — Leucine Aminopeptidase, subunit E, domain 1

Domain ID domain_id	7srvB02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	630 — Aminopeptidase
Homologous superfamily homologous superfamily	10 — Zn peptidases

Domain ID domain_id	7srvC01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	220 — Leucine Aminopeptidase, subunit E; domain 1
Homologous superfamily homologous superfamily	10 — Leucine Aminopeptidase, subunit E, domain 1

Domain ID domain_id	7srvC02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	630 — Aminopeptidase
Homologous superfamily homologous superfamily	10 — Zn peptidases

Domain ID domain_id	7srvD01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	220 — Leucine Aminopeptidase, subunit E; domain 1
Homologous superfamily homologous superfamily	10 — Leucine Aminopeptidase, subunit E, domain 1

Domain ID domain_id	7srvD02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	630 — Aminopeptidase
Homologous superfamily homologous superfamily	10 — Zn peptidases

Domain ID domain_id	7srvE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	220 — Leucine Aminopeptidase, subunit E; domain 1
Homologous superfamily homologous superfamily	10 — Leucine Aminopeptidase, subunit E, domain 1

Domain ID domain_id	7srvE02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	630 — Aminopeptidase
Homologous superfamily homologous superfamily	10 — Zn peptidases

Domain ID domain_id	7srvF01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	220 — Leucine Aminopeptidase, subunit E; domain 1
Homologous superfamily homologous superfamily	10 — Leucine Aminopeptidase, subunit E, domain 1

Domain ID domain_id	7srvF02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	630 — Aminopeptidase
Homologous superfamily homologous superfamily	10 — Zn peptidases

▶

8. Citations (1)

▶

Unit-cell length a length_a	111.542 Å
Unit-cell length b length_b	172.670 Å
Unit-cell length c length_c	179.395 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 2 21 21
Space-group number int_tables_number	18
Crystal system crystal_system	orthorhombic

Resolution resolution	2.030 Å
Low-resolution limit resolution_low	49.190 Å
R factor r_factor	0.1900
R_work r_work	0.1885
R_free r_free	0.2188

fit	/app/data/saxs_computation/sr/7srv/7srv.fit
pddf	/app/data/pr_computation/sr/7srv/7srv.pr.out
profile	/app/data/saxs_computation/sr/7srv/7srv.dat