7td5

Structure of human PRC2-EZH1 containing phosphorylated SUZ12

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone-lysine N-methyltransferase EZH1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Polycomb protein EED × 1 （O75530） Polycomb protein SUZ12 × 1 （Q15022） THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER × 1 THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA × 1 ZINC ION × 8 S-ADENOSYLMETHIONINE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Polycomb protein EED × 1 （O75530） Polycomb protein SUZ12 × 1 （Q15022） THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER × 1 THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA × 1 ZINC ION × 8 S-ADENOSYLMETHIONINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EZH1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–747； UniProt 1–747 Author chain F； PDBConstruct 1–747； UniProt 1–747

Polycomb protein EED

Homo sapiens

UniProt O75530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Histone-lysine N-methyltransferase EZH1 × 1 （Q92800） Polycomb protein SUZ12 × 1 （Q15022） THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER × 1 THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA × 1 ZINC ION × 8 S-ADENOSYLMETHIONINE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Histone-lysine N-methyltransferase EZH1 × 1 （Q92800） Polycomb protein SUZ12 × 1 （Q15022） THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER × 1 THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA × 1 ZINC ION × 8 S-ADENOSYLMETHIONINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EED_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 9–373； UniProt 77–441 Author chain G； PDBConstruct 9–373； UniProt 77–441

Polycomb protein SUZ12

Homo sapiens

UniProt Q15022

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 5	Histone-lysine N-methyltransferase EZH1 × 1 （Q92800） Polycomb protein EED × 1 （O75530） THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER × 1 THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA × 1 ZINC ION × 8 S-ADENOSYLMETHIONINE × 1	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	Histone-lysine N-methyltransferase EZH1 × 1 （Q92800） Polycomb protein EED × 1 （O75530） THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER × 1 THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA × 1 ZINC ION × 8 S-ADENOSYLMETHIONINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SUZ12_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–179； UniProt 561–739 Author chain H； PDBConstruct 1–179； UniProt 561–739

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7td5
Deposition date deposition_date	2021-12-30
Structure title title	Structure of human PRC2-EZH1 containing phosphorylated SUZ12
Keywords keywords	Transcription regulatory complex, Histone modification, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7td5__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7td5__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7td5__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.34 Å
Rg (electron density)	33.92 Å
Total Rg	34.57 Å
Atom count	8305
Residues	1020
Excluded volume	147330 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7td5__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7td5__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Histone-lysine N-methyltransferase EZH1
Molecular weight formula_weight	85394.1 kDa
EC 编号 ec_number	2.1.1.356
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F
Atom count atom_count	16191

MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEWKKLRVQPVQSMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILKLPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 2 Entity 2 polymer

Description description	Polycomb protein EED
Molecular weight formula_weight	43170.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G

SWSHPQFEKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAINELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASIWRWDRLR

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 3 Entity 3 polymer

Description description	Polycomb protein SUZ12
Molecular weight formula_weight	20841.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,H

HNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Saccharomyces cerevisiae S288C

Entity 4 Entity 4 polymer

Description description	THR-LYS-ALA-ALA-ARG-MET-SER-ALA-PRO-SER
Molecular weight formula_weight	1021.2 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,I

TKAARMSAPS

Entity 5 Entity 5 polymer

Description description	THR-LYS-ALA-ALA-ARG-M3L-SER-ALA-PRO-ALA
Molecular weight formula_weight	1045.3 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,J

TKAARKSAPA

Entity 6 Entity 6 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	16

Entity 7 Entity 7 non-polymer

Description description	S-ADENOSYLMETHIONINE
Molecular weight formula_weight	398.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

Unit-cell length a length_a	231.870 Å
Unit-cell length b length_b	64.428 Å
Unit-cell length c length_c	254.496 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	109.89 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.994 Å
Low-resolution limit resolution_low	42.520 Å
R factor r_factor	—
R_work r_work	0.1957
R_free r_free	0.2299

Structure of human PRC2-EZH1 containing phosphorylated SUZ12

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone-lysine N-methyltransferase EZH1

State in the Current Structure

Other States of the Same Protein in the Database

Polycomb protein EED

State in the Current Structure

Other States of the Same Protein in the Database

Polycomb protein SUZ12

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7td5__assembly_1__model_1

7td5__assembly_1__model_1 | I(q)

7td5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)

Structure of human PRC2-EZH1 containing phosphorylated SUZ12

1. Protein Identity and Related Structures Protein Identity & Related Structures

Histone-lysine N-methyltransferase EZH1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Polycomb protein EED

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Polycomb protein SUZ12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7td5__assembly_1__model_1

7td5__assembly_1__model_1 | I(q)

7td5__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)