SAXSdb — 7umk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

Vesicular stomatitis Indiana virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 432 RNA 144	Matrix protein × 288 （P03519） ;RNA (5'-R(PUPUPUPUPUPUPUPUP*U)-3') ; × 144	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 3 RNA 1	Matrix protein × 2 （P03519） ;RNA (5'-R(PUPUPUPUPUPUPUPUP*U)-3') ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCAP_VSIVA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–422； UniProt 1–422

Matrix protein

Vesicular stomatitis Indiana virus

UniProt P03519

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 432 RNA 144	Nucleoprotein × 144 （P03521） ;RNA (5'-R(PUPUPUPUPUPUPUPUP*U)-3') ; × 144	Consistent with all polymers
2	Protein–RNA	Heteromer	Protein 3 RNA 1	Nucleoprotein × 1 （P03521） ;RNA (5'-R(PUPUPUPUPUPUPUPUP*U)-3') ; × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MATRX_VSIVA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–229； UniProt 1–229 Author chain C； PDBConstruct 1–229； UniProt 1–229

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7umk
Deposition date deposition_date	2022-04-07
Structure title title	Structure of vesicular stomatitis virus (helical reconstruction, 4.1 A resolution)
Keywords keywords	;Vesicular stomatitis virus, bullet-shaped particle, Rhrabdovirus, nucleocapsid, helical reconstruction, cryo electron microscopy, nucleoprotein, matrix protein, RNA, assembly, VIRUS ;; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7umk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7umk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7umk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	233.20 Å
Total Rg	232.80 Å
Atom count	1815840
Residues	113328
Excluded volume	16370000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7umk__assembly_1__model_1`	576-meric （576）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7umk__assembly_2__model_1`	tetrameric （4）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Nucleoprotein
Molecular weight formula_weight	47463.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	12610

MSVTVKRIIDNTVIVPKLPANEDPVEYPADYFRKSKEIPLYINTTKSLSDLRGYVYQGLKSGNVSIIHVNSYLYGALKDIRGKLDKDWSSFGINIGKAGDTIGIFDLVSLKALDGVLPDGVSDASRTSADDKWLPLYLLGLYRVGRTQMPEYRKKLMDGLTNQCKMINEQFEPLVPEGRDIFDVWGNDSNYTKIVAAVDMFFHMFKKHECASFRYGTIVSRFKDCAALATFGHLCKITGMSTEDVTTWILNREVADEMVQMMLPGQEIDKADSYMPYLIDFGLSSKSPYSSVKNPAFHFWGQLTALLLRSTRARNARQPDDIEYTSLTTAGLLYAYAVGSSADLAQQFCVGDNKYTPDDSTGGLTTNAPPQGRDVVEWLGWFEDQNRKPTPDMMQYAKRAVMSLQGLREKTIGKYAKSEFDK

Source Source

Source organism organism	Vesicular stomatitis Indiana virus
NCBI taxonomy ID ncbi_taxonomy_id	11277
Host organism host_organism	Mesocricetus auratus

Entity 2 Entity 2 polymer

Description description	Matrix protein
Molecular weight formula_weight	26103.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MSSLKKILGLKGKGKKSKKLGIAPPPYEEDTSMEYAPSAPIDKSYFGVDEMDTYDPNQLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKILAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEHFRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALMFGLIVEKKASGAWVLDSISHFK

Source Source

Source organism organism	Vesicular stomatitis Indiana virus
NCBI taxonomy ID ncbi_taxonomy_id	11277
Host organism host_organism	Mesocricetus auratus

Entity 3 Entity 3 polymer

Description description	;RNA (5'-R(PUPUPUPUPUPUPUPUP*U)-3') ;
Molecular weight formula_weight	2710.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R

UUUUUUUUU

Source Source

Source organism organism	Vesicular stomatitis Indiana virus
NCBI taxonomy ID ncbi_taxonomy_id	11277
Host organism host_organism	Mesocricetus auratus

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	21530

Structure of vesicular stomatitis virus (helical reconstruction, 4.1 A resolution)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Matrix protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7umk__assembly_1__model_1

7umk__assembly_1__model_1 | I(q)

7umk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (2)

Structure of vesicular stomatitis virus (helical reconstruction, 4.1 A resolution)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Matrix protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7umk__assembly_1__model_1

7umk__assembly_1__model_1 | I(q)

7umk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

7. Citations (2)