SAXSdb — 7uzp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Parathyroid hormone/parathyroid hormone-related peptide receptor

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	PTHrP[1-36] 24,28,31 XCP × 3 1,2-ETHANEDIOL × 2 ZINC ION × 1 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PTH1R_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–103； UniProt 29–174 Author chain C； PDBConstruct 2–103； UniProt 29–174 Author chain E； PDBConstruct 2–103； UniProt 29–174

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7uzp
Deposition date deposition_date	2022-05-09
Structure title title	parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing three beta-amino acids
Keywords keywords	parathyroid hormone 1 receptor, signaling, beta-amino acid, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7uzp__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7uzp__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7uzp__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.39 Å
Rg (electron density)	23.37 Å
Total Rg	24.36 Å
Atom count	5823
Residues	359
Excluded volume	53024 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7uzp__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Parathyroid hormone/parathyroid hormone-related peptide receptor
Molecular weight formula_weight	11995.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	5969

GDDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	PTHrP[1-36] 24,28,31 XCP
Molecular weight formula_weight	2779.2 kDa
Source method src_method	syn
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

YQDLRRRFFXHHLXAEXHTAEI

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	145

▶

Unit-cell length a length_a	101.650 Å
Unit-cell length b length_b	58.949 Å
Unit-cell length c length_c	77.924 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	117.57 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	monoclinic

Resolution resolution	2.290 Å
Low-resolution limit resolution_low	34.540 Å
R factor r_factor	0.2107
R_work r_work	0.2090
R_free r_free	0.2427

parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing three beta-amino acids

1. Protein Identity and Related Structures Protein Identity & Related Structures

Parathyroid hormone/parathyroid hormone-related peptide receptor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7uzp__assembly_1__model_1

7uzp__assembly_1__model_1 | I(q)

7uzp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

parathyroid hormone 1 receptor extracellular domain complexed with a peptide ligand containing three beta-amino acids

1. Protein Identity and Related Structures Protein Identity & Related Structures

Parathyroid hormone/parathyroid hormone-related peptide receptor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7uzp__assembly_1__model_1

7uzp__assembly_1__model_1 | I(q)

7uzp__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)