SAXSdb — 7vea

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin alpha chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Allophycocyanin beta chain × 40 （P50031） Phycobiliprotein ApcE × 2 （Q8DGF2） Phycobilisome core component × 2 （Q8DHC5） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （P50036） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHAA_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain aA； PDBConstruct 1–161； UniProt 1–161 Author chain aC； PDBConstruct 1–161； UniProt 1–161 Author chain aE； PDBConstruct 1–161； UniProt 1–161 Author chain aG； PDBConstruct 1–161； UniProt 1–161 Author chain aI； PDBConstruct 1–161； UniProt 1–161 Author chain aK； PDBConstruct 1–161； UniProt 1–161 Author chain aO； PDBConstruct 1–161； UniProt 1–161 Author chain aQ； PDBConstruct 1–161； UniProt 1–161 Author chain bM； PDBConstruct 1–161； UniProt 1–161 Author chain bO； PDBConstruct 1–161； UniProt 1–161 Author chain bQ； PDBConstruct 1–161； UniProt 1–161 Author chain bS； PDBConstruct 1–161； UniProt 1–161 Author chain bU； PDBConstruct 1–161； UniProt 1–161 Author chain bW； PDBConstruct 1–161； UniProt 1–161 Author chain cA； PDBConstruct 1–161； UniProt 1–161 Author chain cC； PDBConstruct 1–161； UniProt 1–161 Author chain cE； PDBConstruct 1–161； UniProt 1–161 Author chain cG； PDBConstruct 1–161； UniProt 1–161 Author chain cI； PDBConstruct 1–161； UniProt 1–161 Author chain cK； PDBConstruct 1–161； UniProt 1–161 Author chain dA； PDBConstruct 1–161； UniProt 1–161 Author chain dC； PDBConstruct 1–161； UniProt 1–161 Author chain dE； PDBConstruct 1–161； UniProt 1–161 Author chain dG； PDBConstruct 1–161； UniProt 1–161 Author chain dI； PDBConstruct 1–161； UniProt 1–161 Author chain dK； PDBConstruct 1–161； UniProt 1–161 Author chain dO； PDBConstruct 1–161； UniProt 1–161 Author chain dQ； PDBConstruct 1–161； UniProt 1–161 Author chain eM； PDBConstruct 1–161； UniProt 1–161 Author chain eO； PDBConstruct 1–161； UniProt 1–161 Author chain eQ； PDBConstruct 1–161； UniProt 1–161 Author chain eS； PDBConstruct 1–161； UniProt 1–161 Author chain eU； PDBConstruct 1–161； UniProt 1–161 Author chain eW； PDBConstruct 1–161； UniProt 1–161 Author chain fA； PDBConstruct 1–161； UniProt 1–161 Author chain fC； PDBConstruct 1–161； UniProt 1–161 Author chain fE； PDBConstruct 1–161； UniProt 1–161 Author chain fG； PDBConstruct 1–161； UniProt 1–161 Author chain fI； PDBConstruct 1–161； UniProt 1–161 Author chain fK； PDBConstruct 1–161； UniProt 1–161

Allophycocyanin beta chain

OrganismNot specified

UniProt P50031

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Allophycocyanin alpha chain × 40 （P50030） Phycobiliprotein ApcE × 2 （Q8DGF2） Phycobilisome core component × 2 （Q8DHC5） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （P50036） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APCB_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain aB； PDBConstruct 1–161； UniProt 1–161 Author chain aD； PDBConstruct 1–161； UniProt 1–161 Author chain aF； PDBConstruct 1–161； UniProt 1–161 Author chain aH； PDBConstruct 1–161； UniProt 1–161 Author chain aJ； PDBConstruct 1–161； UniProt 1–161 Author chain aL； PDBConstruct 1–161； UniProt 1–161 Author chain aN； PDBConstruct 1–161； UniProt 1–161 Author chain aP； PDBConstruct 1–161； UniProt 1–161 Author chain bN； PDBConstruct 1–161； UniProt 1–161 Author chain bP； PDBConstruct 1–161； UniProt 1–161 Author chain bR； PDBConstruct 1–161； UniProt 1–161 Author chain bT； PDBConstruct 1–161； UniProt 1–161 Author chain bV； PDBConstruct 1–161； UniProt 1–161 Author chain bX； PDBConstruct 1–161； UniProt 1–161 Author chain cB； PDBConstruct 1–161； UniProt 1–161 Author chain cD； PDBConstruct 1–161； UniProt 1–161 Author chain cF； PDBConstruct 1–161； UniProt 1–161 Author chain cH； PDBConstruct 1–161； UniProt 1–161 Author chain cJ； PDBConstruct 1–161； UniProt 1–161 Author chain cL； PDBConstruct 1–161； UniProt 1–161 Author chain dB； PDBConstruct 1–161； UniProt 1–161 Author chain dD； PDBConstruct 1–161； UniProt 1–161 Author chain dF； PDBConstruct 1–161； UniProt 1–161 Author chain dH； PDBConstruct 1–161； UniProt 1–161 Author chain dJ； PDBConstruct 1–161； UniProt 1–161 Author chain dL； PDBConstruct 1–161； UniProt 1–161 Author chain dN； PDBConstruct 1–161； UniProt 1–161 Author chain dP； PDBConstruct 1–161； UniProt 1–161 Author chain eN； PDBConstruct 1–161； UniProt 1–161 Author chain eP； PDBConstruct 1–161； UniProt 1–161 Author chain eR； PDBConstruct 1–161； UniProt 1–161 Author chain eT； PDBConstruct 1–161； UniProt 1–161 Author chain eV； PDBConstruct 1–161； UniProt 1–161 Author chain eX； PDBConstruct 1–161； UniProt 1–161 Author chain fB； PDBConstruct 1–161； UniProt 1–161 Author chain fD； PDBConstruct 1–161； UniProt 1–161 Author chain fF； PDBConstruct 1–161； UniProt 1–161 Author chain fH； PDBConstruct 1–161； UniProt 1–161 Author chain fJ； PDBConstruct 1–161； UniProt 1–161 Author chain fL； PDBConstruct 1–161； UniProt 1–161

Phycobiliprotein ApcE

OrganismNot specified

UniProt Q8DGF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Allophycocyanin alpha chain × 40 （P50030） Allophycocyanin beta chain × 40 （P50031） Phycobilisome core component × 2 （Q8DHC5） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （P50036） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DGF2_THEEB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain aM； PDBConstruct 1–1139； UniProt 1–1139 Author chain dM； PDBConstruct 1–1139； UniProt 1–1139

Phycobilisome core component

OrganismNot specified

UniProt Q8DHC5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Allophycocyanin alpha chain × 40 （P50030） Allophycocyanin beta chain × 40 （P50031） Phycobiliprotein ApcE × 2 （Q8DGF2） Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core × 6 （P50036） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8DHC5_THEEB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain aR； PDBConstruct 1–169； UniProt 1–169 Author chain dR； PDBConstruct 1–169； UniProt 1–169

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

OrganismNot specified

UniProt P50036

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 90	Allophycocyanin alpha chain × 40 （P50030） Allophycocyanin beta chain × 40 （P50031） Phycobiliprotein ApcE × 2 （Q8DGF2） Phycobilisome core component × 2 （Q8DHC5） PHYCOCYANOBILIN × 84	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYC1_THEEB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain aS； PDBConstruct 1–67； UniProt 1–67 Author chain bY； PDBConstruct 1–67； UniProt 1–67 Author chain cM； PDBConstruct 1–67； UniProt 1–67 Author chain dS； PDBConstruct 1–67； UniProt 1–67 Author chain eY； PDBConstruct 1–67； UniProt 1–67 Author chain fM； PDBConstruct 1–67； UniProt 1–67

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7vea
Deposition date deposition_date	2021-09-08
Structure title title	Pentacylindrical allophycocyanin core from Thermosynechococcus vulcanus
Keywords keywords	Light-harvesting complex, Phycobilisome, Energy transfer, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7vea__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7vea__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7vea__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	83.46 Å
Rg (electron density)	82.08 Å
Total Rg	81.62 Å
Atom count	111542
Residues	15552
Excluded volume	1961100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7vea__assembly_1__model_1`	90-meric （90）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Allophycocyanin alpha chain
Molecular weight formula_weight	17555.9 kDa
Source method src_method	nat
Copy count entity_count	40

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aA,aC,aE,aG,aI,aK,aO,aQ,bM,bO,bQ,bS,bU,bW,cA,cC,cE,cG,cI,cK,dA,dC,dE,dG,dI,dK,dO,dQ,eM,eO,eQ,eS,eU,eW,fA,fC,fE,fG,fI,fK
Atom count atom_count	111542

MSVVTKSIVNADAEARYLSPGELDRIKNFVSTGERRLRIAQTLTENRERIVKQAGDQLFQKRPDVVSPGGNAYGEEMTATCLRDLDYYLRLVTYGIVAGDVTPIEEIGLVGVREMYNSLGTPIPAVAEGIRAMKNVACSLLSAEDAAEAGSYFDFVIGAMQ

Entity 2 Entity 2 polymer

Description description	Allophycocyanin beta chain
Molecular weight formula_weight	17388.9 kDa
Source method src_method	nat
Copy count entity_count	40

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aB,aD,aF,aH,aJ,aL,aN,aP,bN,bP,bR,bT,bV,bX,cB,cD,cF,cH,cJ,cL,dB,dD,dF,dH,dJ,dL,dN,dP,eN,eP,eR,eT,eV,eX,fB,fD,fF,fH,fJ,fL

MQDAITAVINASDVQGKYLDTAAMEKLKAYFATGELRVRAASVISANAANIVKEAVAKSLLYSDITRPGGNMYTTRRYAACIRDLDYYLRYATYAMLAGDPSILDERVLNGLKETYNSLGVPIAATVQAIQAMKEVTASLVGADAGKEMGIYFDYICSGLS

Entity 3 Entity 3 polymer

Description description	Phycobiliprotein ApcE
Molecular weight formula_weight	127772.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aM,dM

MVVKASGGSSVARPQLYQTVPVSTIIQAEQQDRFLNRGELDELAVYLRSGAKRLEIATTLTRNADIIVSRAANRIFVGGSPMAFLSRPQTEEAPQFTTGARGEAIDIKEAMKLGTATYVDTRGGFLEGLRSIFSASSGGAPVGFKPINIARYGPARMEKSLRDLDWFLRYTTYAIVAGDPNILAVNTRGLREIIEAACSSDATIAALQEMRRAALSYFEKDAEAKGIVETYFDVLINEFIAPAPSDKVRQRNSTDLQGLQLPQIYFNAAERRPKFVMKPGLSAAEKNEVVKAAYRQIFERDISRAYGLGISDLESKVKNGSISMKEFIRQLAKSPLYRKNFYEPYINSRALELAFRHILGRGPSSREEVQTYFAIISKGGLPALVDALVDSKEYSDYFGEETVPYLRGLGQEAQECRNWGAQQDLFKYSAPFRKVPQFITTFAAQDQPLPDQHPYGSGNDPLEIQFGAIFPKEKKNPSARPQPFNKDTRRILIARGPGINNQVSNPGARGLTPGTLGPKVFKLDQLPSINARIGKRSIATGTDSVKFAESSTQRVIRAAYLQVFGRDVYEGQRQKVAEIKLENGEISVREFVRILAKSNLFRSLYWTPLYVTKAIEYIHRRLLGRPTYGRQEMNAYFDIASKKGLYGLVDAIIDSQEYSEAFGEDTVPYERYITPQGLALRSLRVGTIGETGVPPEKEETPRFVELGAVTELRTEPAIQFRANQGVSKRREQTKVFKLTDLNDKQNLQLVIQAAYRQVFERDVAPYIVRDEFTALESKLSNGEITLKEFIEALGCSELYQKEFYTPYPNTKVIELGTKHFLGRAPLDQAEIRRYNQILATQGLKAFVQALVSSAEYAQAFGEDTVPYRRFPTLPAANFPNTEKLHNQLTKQSDAIVVPSFAPVKPRLDNTKLPLLSRAIAEQEAKARQADPSKPRFIELGRSFRNGDGQSVEVGVGTTRRRPARIFRMTVGAPSAEVELVINAIYCQVMDVFSGQVPSQFRRPDLESRLRNGEITVREFVRTLASSEIYRNRFYTPYPNTKVIEFLFRHLLGRAPATQAEIRQYNKILADQGLKTAVETMVNSPEYSRYFGEDVVPYKRFPTLPAGNYIGSVKADADLVKQSWSSLSPSLVGIQPSHRD

Entity 4 Entity 4 polymer

Description description	Phycobilisome core component
Molecular weight formula_weight	18757.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aR,dR

MRDAVTTLIKNYDSTGRYLDRDAVDRLRSYFNSGAARVKAAAVINANAAAIVKEAASALFTEQPELIQPGGNAYTTRRYATCLRDMDYYLRYASYAIVAGDVDVLNERVLEGLRETYNSLGVPIGPTVRGIQIMKEIVRDRVAAAGIEDTGIVEQPFDYMCRQLSEVNI

Entity 5 Entity 5 polymer

Description description	Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core
Molecular weight formula_weight	7876.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	aS,bY,cM,dS,eY,fM

MRMFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELFTGKPGVNTGLA

Entity 6 Entity 6 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	84

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	25532

Pentacylindrical allophycocyanin core from Thermosynechococcus vulcanus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Allophycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome core component

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7vea__assembly_1__model_1

7vea__assembly_1__model_1 | I(q)

7vea__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Pentacylindrical allophycocyanin core from Thermosynechococcus vulcanus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Allophycocyanin alpha chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Allophycocyanin beta chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobiliprotein ApcE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome core component

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 7.8 kDa linker polypeptide, allophycocyanin-associated, core

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7vea__assembly_1__model_1

7vea__assembly_1__model_1 | I(q)

7vea__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)