SAXSdb — 7veb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha subunit

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	C-phycocyanin beta subunit × 12 （P50033） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50035） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50034） Phycobilisome rod-core linker polypeptide CpcG2 × 1 （P50040） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCA_THEEB
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–162； UniProt 1–162 Author chain C； PDBConstruct 1–162； UniProt 1–162 Author chain E； PDBConstruct 1–162； UniProt 1–162 Author chain G； PDBConstruct 1–162； UniProt 1–162 Author chain I； PDBConstruct 1–162； UniProt 1–162 Author chain K； PDBConstruct 1–162； UniProt 1–162 Author chain M； PDBConstruct 1–162； UniProt 1–162 Author chain O； PDBConstruct 1–162； UniProt 1–162 Author chain Q； PDBConstruct 1–162； UniProt 1–162 Author chain S； PDBConstruct 1–162； UniProt 1–162 Author chain U； PDBConstruct 1–162； UniProt 1–162 Author chain W； PDBConstruct 1–162； UniProt 1–162

C-phycocyanin beta subunit

OrganismNot specified

UniProt P50033

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	C-phycocyanin alpha subunit × 12 （P50032） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50035） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50034） Phycobilisome rod-core linker polypeptide CpcG2 × 1 （P50040） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PHCB_THEEB
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–172； UniProt 1–172 Author chain D； PDBConstruct 1–172； UniProt 1–172 Author chain F； PDBConstruct 1–172； UniProt 1–172 Author chain H； PDBConstruct 1–172； UniProt 1–172 Author chain J； PDBConstruct 1–172； UniProt 1–172 Author chain L； PDBConstruct 1–172； UniProt 1–172 Author chain N； PDBConstruct 1–172； UniProt 1–172 Author chain P； PDBConstruct 1–172； UniProt 1–172 Author chain R； PDBConstruct 1–172； UniProt 1–172 Author chain T； PDBConstruct 1–172； UniProt 1–172 Author chain V； PDBConstruct 1–172； UniProt 1–172 Author chain X； PDBConstruct 1–172； UniProt 1–172

Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod

OrganismNot specified

UniProt P50035

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	C-phycocyanin alpha subunit × 12 （P50032） C-phycocyanin beta subunit × 12 （P50033） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50034） Phycobilisome rod-core linker polypeptide CpcG2 × 1 （P50040） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYS1_THEEB
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain Y； PDBConstruct 1–78； UniProt 1–78

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

OrganismNot specified

UniProt P50034

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	C-phycocyanin alpha subunit × 12 （P50032） C-phycocyanin beta subunit × 12 （P50033） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50035） Phycobilisome rod-core linker polypeptide CpcG2 × 1 （P50040） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYR1_THEEB
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain Z； PDBConstruct 1–287； UniProt 1–287

Phycobilisome rod-core linker polypeptide CpcG2

OrganismNot specified

UniProt P50040

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 27	C-phycocyanin alpha subunit × 12 （P50032） C-phycocyanin beta subunit × 12 （P50033） Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50035） Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod × 1 （P50034） PHYCOCYANOBILIN × 36	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PYG2_THEEB
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain a； PDBConstruct 1–246； UniProt 1–246

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7veb
Deposition date deposition_date	2021-09-08
Structure title title	Phycocyanin rod structure of cyanobacterial phycobilisome
Keywords keywords	Phycobilisome, Phycocyanin rod, Light-harvesting, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7veb__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7veb__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7veb__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.86 Å
Rg (electron density)	49.13 Å
Total Rg	49.43 Å
Atom count	35524
Residues	4525
Excluded volume	631350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7veb__assembly_1__model_1`	27-meric （27）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	C-phycocyanin alpha subunit
Molecular weight formula_weight	17456.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,G,I,K,M,O,Q,S,U,W
Atom count atom_count	35530

MKTPITEAIAAADTQGRFLSNTELQAVDGRFKRAVASMEAARALTNNAQSLIDGAAQAVYQKFPYTTTMQGSQYASTPEGKAKCARDIGYYLRMVTYCLVAGGTGPMDEYLIAGLSEINSTFDLSPSWYIEALKYIKANHGLTGQAAVEANAYIDYAINALS

Entity 2 Entity 2 polymer

Description description	C-phycocyanin beta subunit
Molecular weight formula_weight	18216.7 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F,H,J,L,N,P,R,T,V,X

MLDAFAKVVAQADARGEFLTNAQFDALSNLVKEGNKRLDAVNRITSNASTIVANAARALFAEQPQLIQPGGNAYTNRRMAACLRDMEIILRYVTYAILAGDSSVLDDRCLNGLRETYQALGTPGSSVAVAIQKMKDAAIAIANDPNGITPGDCSALMSEIAGYFDRAAAAVA

Entity 3 Entity 3 polymer

Description description	Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod
Molecular weight formula_weight	8681.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MFGQTASGSAALSPSGARVFRYEVVGLRQNEETDRMEFPIRRSGSTFITVPYNRMNEEMQRITRMGGKIVSITPVVAS

Entity 4 Entity 4 polymer

Description description	Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod
Molecular weight formula_weight	32158.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAITAAASRLGTSAFSDAPPVELRANWSEEDLETVIRAVYRQVLGNDYVMASERLVSAESLLRNGKITVREFVRAVAKSELYKEKFLYGNFQTRVIELNYKHLLGRAPYDESEVIFHLDLYENEGFDADIDSYIDSPEYTNSFGDWVVPYYRGFNTQPGQKTVGFNRIFRLYRGYANSDRAQAEGSMSRLARDLATNRANTVVPPSNSDTAFAYYTPSADVPPRACLGGSFGESGRVYRIEVAGIRQPGYPGVRRSSTAFLVPYEQLSAKMQQLQRTGARIISVNPA

Entity 5 Entity 5 polymer

Description description	Phycobilisome rod-core linker polypeptide CpcG2
Molecular weight formula_weight	28817.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MTIPLLSYAPSSQNQRVAGYEVPNEETPWRYSLEDAVDQSDIDELIWAAYRQVFSEHVVLKSTRQPHLESQLANRAISVRDFIRGLAKSETFRRLVVETNSNYRLVEIALKRLLGRAPYNKQEELAWSIRIATDGWQKFVDTLVDSDEYTQNFGDNTVPYQRRRYKDRPFNLVTPRYSDYWRDKLENSRYKWGDIRNFLEMARSVKVTPVQFKPVSTANVQIPDTTRRDRPTVPASINPTASFPLR

Entity 6 Entity 6 non-polymer

Description description	PHYCOCYANOBILIN
Molecular weight formula_weight	588.7 kDa
Source method src_method	syn
Copy count entity_count	36

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	159537

Phycocyanin rod structure of cyanobacterial phycobilisome

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

C-phycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

Phycobilisome rod-core linker polypeptide CpcG2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7veb__assembly_1__model_1

7veb__assembly_1__model_1 | I(q)

7veb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)

Phycocyanin rod structure of cyanobacterial phycobilisome

1. Protein Identity and Related Structures Protein Identity & Related Structures

C-phycocyanin alpha subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

C-phycocyanin beta subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 8.9 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome 32.1 kDa linker polypeptide, phycocyanin-associated, rod

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Phycobilisome rod-core linker polypeptide CpcG2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7veb__assembly_1__model_1

7veb__assembly_1__model_1 | I(q)

7veb__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

7. Citations (1)