7wfg

Subcomplexes A and E in NDH complex from Arabidopsis

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NAD(P)H-quinone oxidoreductase subunit H, chloroplastic

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （P56755） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （P56754） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （P56756） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （Q9CAC5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （Q2V2S7） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （Q9LVM2） NdhO × 1 （A0A178WB24） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHH_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain H； PDBConstruct 1–393； UniProt 1–393

NAD(P)H-quinone oxidoreductase subunit I, chloroplastic

OrganismNot specified

UniProt P56755

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （P56753） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （P56754） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （P56756） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （Q9CAC5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （Q2V2S7） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （Q9LVM2） NdhO × 1 （A0A178WB24） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHI_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain I； PDBConstruct 1–172； UniProt 1–172

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

OrganismNot specified

UniProt P56754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （P56753） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （P56755） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （P56756） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （Q9CAC5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （Q2V2S7） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （Q9LVM2） NdhO × 1 （A0A178WB24） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHJ_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain J； PDBConstruct 1–158； UniProt 1–158

NAD(P)H-quinone oxidoreductase subunit K, chloroplastic

OrganismNot specified

UniProt P56756

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （P56753） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （P56755） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （P56754） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （Q9CAC5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （Q2V2S7） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （Q9LVM2） NdhO × 1 （A0A178WB24） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHK_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–225； UniProt 1–225

NAD(P)H-quinone oxidoreductase subunit L, chloroplastic

OrganismNot specified

UniProt Q9CAC5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （P56753） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （P56755） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （P56754） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （P56756） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （Q2V2S7） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （Q9LVM2） NdhO × 1 （A0A178WB24） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHL_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain L； PDBConstruct 1–191； UniProt 1–191

NAD(P)H-quinone oxidoreductase subunit M, chloroplastic

OrganismNot specified

UniProt Q2V2S7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （P56753） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （P56755） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （P56754） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （P56756） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （Q9CAC5） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （Q9LVM2） NdhO × 1 （A0A178WB24） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHM_ARATH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–217； UniProt 1–217

NAD(P)H-quinone oxidoreductase subunit N, chloroplastic

OrganismNot specified

UniProt Q9LVM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （P56753） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （P56755） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （P56754） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （P56756） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （Q9CAC5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （Q2V2S7） NdhO × 1 （A0A178WB24） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDHN_ARATH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain N； PDBConstruct 1–209； UniProt 1–209

NdhO

OrganismNot specified

UniProt A0A178WB24

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 9	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic × 1 （P56753） NAD(P)H-quinone oxidoreductase subunit I, chloroplastic × 1 （P56755） NAD(P)H-quinone oxidoreductase subunit J, chloroplastic × 1 （P56754） NAD(P)H-quinone oxidoreductase subunit K, chloroplastic × 1 （P56756） NAD(P)H-quinone oxidoreductase subunit L, chloroplastic × 1 （Q9CAC5） NAD(P)H-quinone oxidoreductase subunit M, chloroplastic × 1 （Q2V2S7） NAD(P)H-quinone oxidoreductase subunit N, chloroplastic × 1 （Q9LVM2） NdhT × 1 IRON/SULFUR CLUSTER × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A178WB24_ARATH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain O； PDBConstruct 1–158； UniProt 1–158

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7wfg
Deposition date deposition_date	2021-12-26
Structure title title	Subcomplexes A and E in NDH complex from Arabidopsis
Keywords keywords	Subcomplex A, subcomplex E, supercomplex, Arabidopsis, plant, cyclic electron transport, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7wfg__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7wfg__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7wfg__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.76 Å
Rg (electron density)	33.98 Å
Total Rg	34.23 Å
Atom count	9836
Residues	1368
Excluded volume	174160 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7wfg__assembly_1__model_1`	nonameric （9）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit H, chloroplastic
Molecular weight formula_weight	45553.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H
Atom count atom_count	9836

MKRPVTGKDLMIVNMGPHHPSMHGVLRLIVTLDGEDVVDCEPILGYLHRGMEKIAENRAIIQYLPYVTRWDYLATMFTEAITVNGPEQLGNIQVPKRASYIRVIMLELSRIASHLLWLGPFMADIGAQTPFFYIFREREFVYDLFEAATGMRMMHNFFRIGGIAADLPYGWIDKCLDFCDYFLTEVVEYQKLITRNPIFLERVEGVGIIGGEEAINWGLSGPMLRASGIPWDLRKIDRYESYDEFEWEIQWQKQGDSLARYLVRLSEMTESIKIIQQALEGLPGGPYENLESRGFDRKRNPEWNDFEYRFISKKPSPTFELSKQELYVRVEAPKGELGIFLIGDQSGFPWRWKIRPPGFINLQILPELVKRMKLADIMTILGSIDIIMGEVDR

Entity 2 Entity 2 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit I, chloroplastic
Molecular weight formula_weight	20107.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLPMITGFMNYGQQTLRAARYIGQGFMITLSHTNRLPVTIQYPYEKLITSERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWKLETNIRKKRLLNYSIDFGICIFCGNCVEYCPTNCLSMTEEYEFSTYDRHELNYNQIALGRLPMSVIDDYTIRTIWNSPQTKNGVNPLI

Entity 3 Entity 3 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit J, chloroplastic
Molecular weight formula_weight	18579.2 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MQGTLSVWLAKRGLVHRSLGFDYQGIETLQIKPEDWHSIAVILYVYGYNYLRSQCAYDVAPGGLLASVYHLTRIEYGVNQAEEVCIKVFTHRSNPRIPSVFWVWKSTDFQERESYDMLGITYDSHPRLKRILMPESWIGWPLRKDYIAPNFYEIQDAY

Entity 4 Entity 4 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit K, chloroplastic
Molecular weight formula_weight	25396.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MNSIKFPILDRTTKNSVISTTLNDLSNWSRLSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGTVTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLIPVDVYLPGCPPKPEAVIDAITKLRKKIAREIYKDRIRPQQGNRCFTTNHKFFVVRSPHIGNYDQELLYPPSSTSEISTETFFKYKSPVSSHELVN

Entity 5 Entity 5 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit L, chloroplastic
Molecular weight formula_weight	21987.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSRCGSLGLYAPNALPSLSLKPRSVKSPFCITSHTKPNDTLLHNVNKMRAKACDILGAKKTILAAQLGAVLATIDHPALAITGVNNQQELSSVVLDIGIISVWYFLVMPPIIMNWLRVRWYRRKFFEMYLQFMFVFMFFPGLLLWAPFLNFRKFPRDPNMKNPWDKPTDPDSIKNVYLKYPYATPEDYDLD

Entity 6 Entity 6 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit M, chloroplastic
Molecular weight formula_weight	24820.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MVAAFSYTACTKLSLLHPSMVAQIRPRTTQKAFVVTNPEQDSTLEVQETETLKEEQSTEKMKKQPTPLRPVEKQLNVKSKGMGDFGGQWLSSVTRHVRIYAAYIDPETCEFDQSQMDKLTLILDPTEEFVWDDESCNKVYSYFQELVDHYEGAPLTEYTLRLIGSDVEHYIRKMLFDGEIQYNMDARVLNFSMGKPRVQFNTSNIEGGGDGQPQEDA

Entity 7 Entity 7 polymer

Description description	NAD(P)H-quinone oxidoreductase subunit N, chloroplastic
Molecular weight formula_weight	23430.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MGSRAICIQRVAPPCFEASQVKKIKTVGSFLVNTRSKRRRSTGVKCSSIADYIGGDLVKPDIGQWLQDVEEHKAIAIYAPHEGGYEGRYLNRLKMQGYYFLDISARGLGDPETTLLKNYPVCPAHLGKQPIARWYYPPEVDYRLAALPPSAKGLVVWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFVWKPLAEIANLAAQE

Entity 8 Entity 8 polymer

Description description	NdhO
Molecular weight formula_weight	17679.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MAFSATLSQLSSLSTISSSLPISSRRLPHRSLPQFTVKAEAEKEKQSAQAKSDGEASPAATKTPKTLPKKPVYSMKKGQIVRVEKEKYLNSINYLSVGHPPFYKGLDYIYEDRGEVLDLRVFETGEYALVGWVGIPTAPAWLPTDMLIKCEKLVYERM

Entity 9 Entity 9 polymer

Description description	NdhT
Molecular weight formula_weight	10400.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.33 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	76085

Subcomplexes A and E in NDH complex from Arabidopsis

1. Protein Identity and Related Structures Protein Identity & Related Structures

NAD(P)H-quinone oxidoreductase subunit H, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit I, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit J, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit K, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit L, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit M, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NAD(P)H-quinone oxidoreductase subunit N, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NdhO

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7wfg__assembly_1__model_1

7wfg__assembly_1__model_1 | I(q)

7wfg__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (10)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer