SAXSdb — 7xqu

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MHC class I antigen

Felis catus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	Beta-2-microglobulin × 1 （Q5MGS7） peptide from Nucleoprotein × 1 （P25909） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	Beta-2-microglobulin × 1 （Q5MGS7） peptide from Nucleoprotein × 1 （P25909） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q95482_FELCA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–274； UniProt 25–298 Author chain D； PDBConstruct 1–274； UniProt 25–298

Beta-2-microglobulin

Felis catus

UniProt Q5MGS7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	MHC class I antigen × 1 （Q95482） peptide from Nucleoprotein × 1 （P25909） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	MHC class I antigen × 1 （Q95482） peptide from Nucleoprotein × 1 （P25909） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	B2MG_FELCA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 2–99； UniProt 21–118 Author chain E； PDBConstruct 2–99； UniProt 21–118

peptide from Nucleoprotein

OrganismNot specified

UniProt P25909

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	MHC class I antigen × 1 （Q95482） Beta-2-microglobulin × 1 （Q5MGS7） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	MHC class I antigen × 1 （Q95482） Beta-2-microglobulin × 1 （Q5MGS7） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NCAP_FIPV
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–9； UniProt 318–326 Author chain F； PDBConstruct 1–9； UniProt 318–326

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7xqu
Deposition date deposition_date	2022-05-08
Structure title title	The structure of FLA-E*00301/EM-FECV-10
Keywords keywords	Complex, Peptide prensentation, Immune system, STRUCTURAL PROTEIN; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7xqu__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7xqu__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7xqu__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.26 Å
Rg (electron density)	23.15 Å
Total Rg	23.99 Å
Atom count	3142
Residues	382
Excluded volume	54965 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7xqu__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7xqu__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	MHC class I antigen
Molecular weight formula_weight	31878.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D
Atom count atom_count	6357

ASHSLRYFYTAISRPGLGEPRFISVGYVDDTQFVRFDSDAPNPREEPRAPWMEQEGPEYWDRNTRIYLDTAQIFRVDLNTMLRYYNQSESGSHNIQRMYGCDVEPDGRLLRGYSQDSYDGKDYIALNEDLRSWTAADTAAQITRRKWEEAGVAERWRNYLEGLCVESLAKYLDMGKETLLRAESPNTRVTRHPISDREVTLRCWALGFYPAEITLTWQRDGQDHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHKGLPEPINLRW

Source Source

Source organism organism	Felis catus
Common name common_name	domestic cat
NCBI taxonomy ID ncbi_taxonomy_id	9685
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Beta-2-microglobulin
Molecular weight formula_weight	11618.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E

MVQHSPKVQVYSRHPAENGKPNFLNCYVSGFHPPQIDITLMKNGKKMEAEQTDLSFNRDWTFYLLVHTEFTPTVEDEYSCQVNHTTLSEPKVVKWDRDM

Source Source

Source organism organism	Felis catus
Common name common_name	domestic cat
NCBI taxonomy ID ncbi_taxonomy_id	9685
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	peptide from Nucleoprotein
Molecular weight formula_weight	1127.3 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F

FLEQIDAYK

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	82

▶

Unit-cell length a length_a	132.221 Å
Unit-cell length b length_b	132.221 Å
Unit-cell length c length_c	130.846 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 4 21 2
Space-group number int_tables_number	90
Crystal system crystal_system	tetragonal

Resolution resolution	2.600 Å
Low-resolution limit resolution_low	38.040 Å
R factor r_factor	0.2219
R_work r_work	0.2191
R_free r_free	0.2757

The structure of FLA-E*00301/EM-FECV-10

1. Protein Identity and Related Structures Protein Identity & Related Structures

MHC class I antigen

State in the Current Structure

Other States of the Same Protein in the Database

Beta-2-microglobulin

State in the Current Structure

Other States of the Same Protein in the Database

peptide from Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7xqu__assembly_1__model_1

7xqu__assembly_1__model_1 | I(q)

7xqu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

7. Citations (1)

The structure of FLA-E*00301/EM-FECV-10

1. Protein Identity and Related Structures Protein Identity & Related Structures

MHC class I antigen

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Beta-2-microglobulin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

peptide from Nucleoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7xqu__assembly_1__model_1

7xqu__assembly_1__model_1 | I(q)

7xqu__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

7. Citations (1)