7y3f

Structure of the Anabaena PSI-monomer-IsiA supercomplex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAA_NOSS1
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–752； UniProt 1–752

Photosystem I P700 chlorophyll a apoprotein A2 1

OrganismNot specified

UniProt P58565

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAB1_NOSS1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–741； UniProt 1–741

Photosystem I iron-sulfur center

OrganismNot specified

UniProt P0A410

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAC_NOSS1
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–81； UniProt 1–81

Photosystem I reaction center subunit II

OrganismNot specified

UniProt P58573

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAD_NOSS1
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–139； UniProt 1–139

Photosystem I reaction center subunit IV

OrganismNot specified

UniProt P58575

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAE_NOSS1
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–70； UniProt 1–70

Photosystem I reaction center subunit III

OrganismNot specified

UniProt P58564

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAF_NOSS1
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–164； UniProt 1–164

Photosystem I reaction center subunit VIII

OrganismNot specified

UniProt P58560

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAI_NOSS1
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain I； PDBConstruct 1–46； UniProt 1–46

Photosystem I reaction center subunit IX

OrganismNot specified

UniProt P58568

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAJ_NOSS1
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–49； UniProt 1–49

Photosystem I 4.8 kDa protein

OrganismNot specified

UniProt P58566

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSAX_NOSS1
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain X； PDBConstruct 1–44； UniProt 1–44

Photosystem I reaction center subunit XI

OrganismNot specified

UniProt Q8YQ34

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） IsiA × 3 Iron stress-induced chlorophyll-binding protein × 2 （Q8YQ35） CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8YQ34_NOSS1
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain 1； PDBConstruct 1–476； UniProt 1–476

Iron stress-induced chlorophyll-binding protein

OrganismNot specified

UniProt Q8YQ35

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Photosystem I P700 chlorophyll a apoprotein A1 × 1 （P58576） Photosystem I P700 chlorophyll a apoprotein A2 1 × 1 （P58565） Photosystem I iron-sulfur center × 1 （P0A410） Photosystem I reaction center subunit II × 1 （P58573） Photosystem I reaction center subunit IV × 1 （P58575） Photosystem I reaction center subunit III × 1 （P58564） Photosystem I reaction center subunit VIII × 1 （P58560） Photosystem I reaction center subunit IX × 1 （P58568） Unknown × 1 PsaM × 1 Photosystem I 4.8 kDa protein × 1 （P58566） Photosystem I reaction center subunit XI × 1 （Q8YQ34） IsiA × 3 CHLOROPHYLL A ISOMER × 1 CHLOROPHYLL A × 155 PHYLLOQUINONE × 2 IRON/SULFUR CLUSTER × 3 BETA-CAROTENE × 29 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 4 DODECYL-BETA-D-MALTOSIDE × 6 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 1 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ISIA_NOSS1
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 4； PDBConstruct 1–344； UniProt 1–344 Author chain 5； PDBConstruct 1–344； UniProt 1–344

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7y3f
Deposition date deposition_date	2022-06-10
Structure title title	Structure of the Anabaena PSI-monomer-IsiA supercomplex
Keywords keywords	Photosystem I, ELECTRON TRANSPORT, isiA, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7y3f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7y3f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7y3f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	58.40 Å
Rg (electron density)	56.16 Å
Total Rg	56.08 Å
Atom count	39437
Residues	4112
Excluded volume	721820 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7y3f__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (23)

Entity 1 Entity 1 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A1
Molecular weight formula_weight	83289.7 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	39463

MTISPPEREEKKARVIVDKDPVPTSFEKWAQPGHFDRTLARGPKTTTWIWNLHALAHDFDTHTSDLEDISRKIFAAHFGHLAVVTIWLSGMIFHGAKFSNYEAWLSDPLNVRPSAQVVWPIVGQDILNGDVGGGFHGIQITSGLFQVWRGWGITNSFQLYCTAIGGLVLAGLFLFAGWFHYHKRAPKLEWFQNVESMLNHHLQVLLGCGSLGWAGHLIHVSAPINKLMDAGVAVKDIPLPHEFILNKSLLIDLFPGFAAGLTPFFTLNWGQYADFLTFKGGLNPVTGGLWMTDIAHHHLAIAVVFIIAGHQYRTNWGIGHSIKEILENHKGPFTGEGHKGLYENLTTSWHAQLATNLAFLGSLTIIIAHHMYAMPPYPYLATDYATQLCIFTHHIWIGGFLIVGGAAHAAIFMVRDYDPVVNQNNVLDRVIRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPVFAQWVQNLHTLAPGGTAPNALEPVSYAFGGGVLAVGGKVAMMPIALGTADFLIHHIHAFTIHVTVLILLKGVLFARSSRLIPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVDAAGNVSHITGGNFAQSAITINGWLRDFLWAQASQVINSYGSALSAYGLMFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLKVAPAIQPRALSITQGRAVGVAHYLLGGIATTWAFFHAHILSVG

Entity 2 Entity 2 polymer

Description description	Photosystem I P700 chlorophyll a apoprotein A2 1
Molecular weight formula_weight	83457.0 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATKFPKFSQDLAQDPTTRRIWYAMAMGNDFESHDGMTEENLYQKIFATHFGHLAIIFLWASSLLFHVAWQGNFEQWIKDPLHVRPIAHAIWDPHFGKPAIEAFTQAGANGPVNIAYSGVYHWWYTIGMRTNTELYTGSVFLLLFASLFLFAGWLHLQPKFRPSLAWFKSAESRLNHHLAGLFGVSSLAWAGHLIHVAIPESRGQHVGWDNFLSTAPHPAGLQPFFTGNWGVYAQNPDTAGHIFSTSQGAGTAILTFLGGFHPQTESLWLTDMAHHHLAIAVLFIVAGHMYRTNFGIGHSIKEMMNAKTFFGKPVEGPFNMPHQGIYDTYNNSLHFQLGWHLACLGVVTSWVAQHMYSLPSYAFIAKDYTTQAALYTHHQYIAIFLMVGAFAHGAIFLVRDYDPEQNKGNVLERVLQHKEAIISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQFIQAAHGKVLYGLDTLLSNPDSVAYTAYPNYANVWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTTLILVKGALDARGSKLMPDKKDFGYAFPCDGPGRGGTCDISAWDSFYLSLFWALNTVGWVTFYWHWKHLGIWQGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSVWAWMFLFGHLVWATGFMFLISWRGYWQELIETLVWAHERTPIANLVRWKDKPVALSIVQARVVGLAHFTVGYVLTYAAFLIASTAGKFG

Entity 3 Entity 3 polymer

Description description	Photosystem I iron-sulfur center
Molecular weight formula_weight	8825.2 kDa
EC 编号 ec_number	1.97.1.12
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MSHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKAAQVASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

Entity 4 Entity 4 polymer

Description description	Photosystem I reaction center subunit II
Molecular weight formula_weight	15176.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAETLSGKTPLFAGSTGGLLTKAVEEEKYAITWTSPKAQVFELPTGGAATMHEGENLLYIARKEYGIALGGQLRKFKITNYKIYRILPSGETTFIHPADGVFPEKVNAGREKVRFNARSIGENPNPSQVKFSGKATYDA

Entity 5 Entity 5 polymer

Description description	Photosystem I reaction center subunit IV
Molecular weight formula_weight	7897.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFDKVNYAGINTNNFAVDELIEVEAPKAKAKK

Entity 6 Entity 6 polymer

Description description	Photosystem I reaction center subunit III
Molecular weight formula_weight	17850.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MRRLFALILVICLSFSFAPPAKALGADLTPCAENPAFQALAKNARNTTADPQSGQKRFERYSQALCGPEGYPHLIVDGRLDRAGDFLIPSILFLYIAGWIGWVGRAYLQAIKKDSDTEQKEIQLDLGIALPIIATGFAWPAAAVKELLSGELTAKDSEITVSPR

Entity 7 Entity 7 polymer

Description description	Photosystem I reaction center subunit VIII
Molecular weight formula_weight	5066.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MATAFLPSILADASFLSSIFVPVIGWVVPIATFSFLFLYIEREDVA

Entity 8 Entity 8 polymer

Description description	Photosystem I reaction center subunit IX
Molecular weight formula_weight	5499.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MADKADQSSYLIKFISTAPVAATIWLTITAGILIEFNRFFPDLLFHPLP

Entity 9 Entity 9 polymer

Description description	Unknown
Molecular weight formula_weight	6996.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 10 Entity 10 polymer

Description description	PsaM
Molecular weight formula_weight	4424.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MPTLYLAQVSSISDTQVYIALVVALIPGLLAWRLATELYK

Entity 11 Entity 11 polymer

Description description	Photosystem I 4.8 kDa protein
Molecular weight formula_weight	4872.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MAKAKISPVANTGAKPPYTFRTGWALLLLAVNFLVAAYYFHIIQ

Entity 12 Entity 12 polymer

Description description	Photosystem I reaction center subunit XI
Molecular weight formula_weight	51717.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MTTATINPQQYGWWAGNARFINLSGRLLGAHIAHAGLIILWAGAMTLFEITKYNPSLPIYEQGLILLPHLATLGFGIGDGGQIIDTYPYFVIGVVHLVSSAVLAAGGIYHALLGPEVLPENNQFPGFFGYDWEDEDKMTTIIGIHLLLLGAGAWLLVAKALFWGGLYDSTVASVRVITEPTVNPARIFGYLFGAFGKQGMAAVNNLEDVVGGHIWVGILCIGGGFWHILTQPFAWAKKVLFWSGEAYLSYSLAALAYMGLLAAYFVTVNDTVYPTEFYGPLGFSSTSGVISVRTWLATSHFALAIVFLSGHIWHALRVRVLEAGLNFEQGVVNYLDTPELGNLQTPINTSDLTLKFLVNLPIYRPGLSAFARGLEIGMAHGYFLLGPFVKLGPLRNTEFANQAGLLATIGLLLILSICLWLYGSAWFQEGKSPQGELPENLKTAKSWSEFNAGWIVGSCGGALFAYLLVTNSSLFF

Entity 13 Entity 13 polymer

Description description	IsiA
Molecular weight formula_weight	27677.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,3,6

XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 14 Entity 14 polymer

Description description	Iron stress-induced chlorophyll-binding protein
Molecular weight formula_weight	37701.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,5

MQTYDNPNIKYDWWAGNARFANLSGLFIGAHVAQAALTTLWAGAFTWFEISRYKPEIPMGEQGLILLPHLATLGFGVGVSGQVVNTYPYFVIGALHLISSAVLGAGALFHTFKGPRNLKNTTGSARKFHFEWNDPKQLGLILGHHLLFLGMAALLLVGKAMFWGGLYDATTQVVRVVNHPTLNPFVIYGYQTHFASVNNLEDLVGGHIYVGLILIGGGIWHIVKEPLPWAKKLLIFSGEAILSYSLGGIALAGFVAAYFCAVNTLAYPVEFYGAPLELKFGVTPYFADTVKLADGGYSARAWLANAHFFLAFFFLQGHLWHALRAIGVDFRQIEKSLNAISSAE

Entity 15 Entity 15 non-polymer

Description description	CHLOROPHYLL A ISOMER
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	155

Entity 17 Entity 17 non-polymer

Description description	PHYLLOQUINONE
Molecular weight formula_weight	450.7 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 19 Entity 19 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	29

Entity 20 Entity 20 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 21 Entity 21 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 22 Entity 22 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 23 Entity 23 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	26

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.62 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	47602

Structure of the Anabaena PSI-monomer-IsiA supercomplex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem I P700 chlorophyll a apoprotein A1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I P700 chlorophyll a apoprotein A2 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I iron-sulfur center

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit II

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IV

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit III

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit IX

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I 4.8 kDa protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem I reaction center subunit XI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer