SAXSdb — 7yzb

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Forkhead box protein H1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain A； UniProt 1–185	Not recorded	;DNA (5'-D(APGPAPTPTPGPTPGPGPAPTPTPGPCPGPA)-3') ; × 1 ;DNA (5'-D(TPCPGPCPAPAPTPCPCPAPCPAPAPTPCPT)-3') ; × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 6.3；277 K；18% PEG 3350, 0.2 M ammonium chloride pH 6.3	Resolution 1.47 Å R-free 0.191

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 7YZB	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5XOC Crystal structure of human Smad3-FoxH1 complex Deposited 2017-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 322–345（24 aa） Fragment：UNP residues 2-109,UNP residues 322-345	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.4；293 K；0.1 M citrate pH 5.4, 0.8% ethylene imine polymer and 0.5 M NaCl	Resolution 2.40 Å R-free 0.235

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	FOXH1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–185； UniProt 1–185

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7yzb
Deposition date deposition_date	2022-02-19
Structure title title	Crystal structure of the human FoxH1 bound to the TGTGGATT site
Keywords keywords	transcription factor, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	18.44 Å
Radius of gyration Rg (electron density) rg_electron	17.35 Å
Forward intensity I(0) i0	15962500.00
Molecular weight molecular_weight	24471.0 kDa
Excluded volume excluded_volume	28178 Å³
Envelope volume envelope_volume	34520 Å³
Hydration-shell volume shell_volume	16796 Å³
Envelope diameter envelope_diameter	61.3 Å
Shell Rg shell_rg	23.25 Å
Envelope Rg envelope_rg	17.62 Å
Shape Rg shape_rg	17.29 Å
Total Rg total_rg	18.27 Å
Total atoms total_atoms	2746
Residues n_residues	157
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	58.6 Å
Rg (real space) rg_real	18.35 Å
Rg uncertainty (real space) rg_real_error	0.34 Å
I(0) (real space) i0_real	1.5960e+07
I(0) uncertainty (real space) i0_real_error	1.9140e+05
Rg (reciprocal space) rg_reciprocal	18.37 Å
I(0) (reciprocal space) i0_reciprocal	15960000.0000
Solution quality estimate total_estimate	0.9028
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	23.3 Å
Skewness Skewness skewness	0.187
Kurtosis Kurtosis kurtosis	-0.459
Angular range angular_range	— – 0.4300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	2277000.0000
Real-space data points n_real_points	74
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.913; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.994

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Forkhead box protein H1
Molecular weight formula_weight	20578.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2977

MGPSSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQIIRQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGAPWPGL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(APGPAPTPTPGPTPGPGPAPTPTPGPCPGPA)-3') ;
Molecular weight formula_weight	4993.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	B

AGATTGTGGATTGCGA

Entity 3 Entity 3 polymer

Description description	;DNA (5'-D(TPCPGPCPAPAPTPCPCPAPCPAPAPTPCPT)-3') ;
Molecular weight formula_weight	4802.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

TCGCAATCCACAATCT

Entity 4 Entity 4 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	152

▶

8. Citations (1)

▶

Unit-cell length a length_a	36.118 Å
Unit-cell length b length_b	78.029 Å
Unit-cell length c length_c	51.879 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	100.46 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.470 Å
Low-resolution limit resolution_low	51.020 Å
R factor r_factor	0.1636
R_work r_work	0.1621
R_free r_free	0.1905

fit	/app/data/saxs_computation/yz/7yzb/7yzb.fit
pddf	/app/data/pr_computation/yz/7yzb/7yzb.pr.out
profile	/app/data/saxs_computation/yz/7yzb/7yzb.dat

Crystal structure of the human FoxH1 bound to the TGTGGATT site

1. Protein Identity and Related Structures Protein Identity & Related Structures

Forkhead box protein H1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)