7zci

Complex I from E. coli, LMNG-purified, under Turnover at pH 6, Resting state

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit F

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A037YNA7_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 1–445； UniProt 1–445

NADH dehydrogenase I subunit E

OrganismNot specified

UniProt A0A829CRH1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A829CRH1_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–166； UniProt 1–166

NADH-quinone oxidoreductase

OrganismNot specified

UniProt A0A037YPU0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A037YPU0_ECOLX
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–908； UniProt 1–908

NADH-quinone oxidoreductase subunit C/D

OrganismNot specified

UniProt A0A024L1E0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A024L1E0_ECOLX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–596； UniProt 1–596

NADH-quinone oxidoreductase subunit B

OrganismNot specified

UniProt V0ZV11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V0ZV11_ECOLX
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–220； UniProt 1–220

NADH-quinone oxidoreductase subunit I

OrganismNot specified

UniProt A0A1X3LLK1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1X3LLK1_ECOLX
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain I； PDBConstruct 1–180； UniProt 1–180

NADH-quinone oxidoreductase subunit H

OrganismNot specified

UniProt E6BKM7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E6BKM7_ECOLX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–325； UniProt 1–325

NADH-quinone oxidoreductase subunit A

OrganismNot specified

UniProt A0A862ZI24

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A862ZI24_ECOLX
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain A； PDBConstruct 1–147； UniProt 1–147

NADH dehydrogenase subunit L

OrganismNot specified

UniProt A0A024L0E1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A024L0E1_ECOLX
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–613； UniProt 1–613

NADH dehydrogenase I subunit M

OrganismNot specified

UniProt C3T2G7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C3T2G7_ECOLX
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain M； PDBConstruct 1–509； UniProt 1–509

NADH-quinone oxidoreductase subunit N

OrganismNot specified

UniProt E2QPD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E2QPD7_ECOLX
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain N； PDBConstruct 1–485； UniProt 1–485

NADH-quinone oxidoreductase subunit K

OrganismNot specified

UniProt A0A7U9LRT0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit J × 1 （A0A0H3MIP2） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7U9LRT0_ECOLX
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 1–100； UniProt 1–100

NADH-quinone oxidoreductase subunit J

OrganismNot specified

UniProt A0A0H3MIP2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 13	NADH-quinone oxidoreductase subunit F × 1 （A0A037YNA7） NADH dehydrogenase I subunit E × 1 （A0A829CRH1） NADH-quinone oxidoreductase × 1 （A0A037YPU0） NADH-quinone oxidoreductase subunit C/D × 1 （A0A024L1E0） NADH-quinone oxidoreductase subunit B × 1 （V0ZV11） NADH-quinone oxidoreductase subunit I × 1 （A0A1X3LLK1） NADH-quinone oxidoreductase subunit H × 1 （E6BKM7） NADH-quinone oxidoreductase subunit A × 1 （A0A862ZI24） NADH dehydrogenase subunit L × 1 （A0A024L0E1） NADH dehydrogenase I subunit M × 1 （C3T2G7） NADH-quinone oxidoreductase subunit N × 1 （E2QPD7） NADH-quinone oxidoreductase subunit K × 1 （A0A7U9LRT0） IRON/SULFUR CLUSTER × 7 FLAVIN MONONUCLEOTIDE × 1 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 FE2/S2 (INORGANIC) CLUSTER × 2 CALCIUM ION × 1 EICOSANE × 5 1,2-Distearoyl-sn-glycerophosphoethanolamine × 11	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0H3MIP2_ECO7I
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain J； PDBConstruct 1–184； UniProt 1–184

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7zci
Deposition date deposition_date	2022-03-28
Structure title title	Complex I from E. coli, LMNG-purified, under Turnover at pH 6, Resting state
Keywords keywords	Complex I, NADH, Quinone, PROTON TRANSPORT; PROTON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7zci__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7zci__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7zci__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	77.49 Å
Rg (electron density)	79.25 Å
Total Rg	79.07 Å
Atom count	36981
Residues	4650
Excluded volume	671440 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7zci__assembly_1__model_1`	tridecameric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (20)

Entity 1 Entity 1 polymer

Description description	NADH-quinone oxidoreductase subunit F
Molecular weight formula_weight	49352.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F
Atom count atom_count	36981

MKNIIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGLSPDEIVNQVKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVNLRRAIAEATEAGLLGKNIMGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPFPATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNISKSKDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFLTEAHLDLPMEFESIGKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARESCGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFREEFEAGIKQPFSNTHLINGIQPNLLKERW

Entity 2 Entity 2 polymer

Description description	NADH dehydrogenase I subunit E
Molecular weight formula_weight	18614.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MHENQQPQTEAFELSAAEREAIEHEMHHYEDPRAASIEALKIVQKQRGWVPDGAIHAIADVLGIPASDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHINGYQGIQAALEKKLNIKPGQTTFDGRFTLLPTCCLGNCDKGPNMMIDEDTHAHLTPEAIPELLERYK

Entity 3 Entity 3 polymer

Description description	NADH-quinone oxidoreductase
Molecular weight formula_weight	100419.2 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MATIHVDGKEYEVNGADNLLEACLSLGLDIPYFCWHPALGSVGACRQCAVKQYQNAEDTRGRLVMSCMTPASDGTFISIDDEEAKQFRESVVEWLMTNHPHDCPVCEEGGNCHLQDMTVMTGHSFRRYRFTKRTHRNQDLGPFISHEMNRCIACYRCVRYYKDYADGTDLGVYGAHDNVYFGRPEDGTLESEFSGNLVEICPTGVFTDKTHSERYNRKWDMQFAPSICQQCSIGCNISPGERYGELRRIENRYNGTVNHYFLCDRGRFGYGYVNLKDRPRQPVQRRGDDFITLNAEQAMQGAADILRQSKKVIGIGSPRASVESNFALRELVGEENFYTGIAHGEQERLQLALKVLREGGIYTPALREIESYDAVLVLGEDVTQTGARVALAVRQAVKGKAREMAAAQKVADWQIAAILNIGQRAKHPLFVTNVDDTRLDDIAAWTYRAPVEDQARLGFAIAHALDNSAPAVDGIEPELQSKIDVIVQALAGAKKPLIISGTNAGSLEVIQAAANVAKALKGRGADVGITMIARSVNSMGLGIMGGGSLEEALTELETGRADAVVVLENDLHRHASAIRVNAALAKAPLVMVVDHQRTAIMENAHLVLSAASFAESDGTVINNEGRAQRFFQVYDPAYYDSKTVMLESWRWLHSLHSTLLSREVDWTQLDHVIDAVVAKIPELAGIKDAAPDATFRIRGQKLAREPHRYSGRTAMRANISVHEPRQPQDIDTMFTFSMEGNNQPTAHRSQVPFAWAPGWNSPQAWNKFQDEVGGKLRFGDPGVRLFETSENGLDYFTSVPARFQPQDGKWRIAPYYHLFGSDELSQRAPVFQSRMPQPYIKLNPADAAKLGVNAGTRVSFSYDGNTVTLPVEIAEGLTAGQVGLPMGMSGIAPVLAGAHLEDLKEAQQ

Entity 4 Entity 4 polymer

Description description	NADH-quinone oxidoreductase subunit C/D
Molecular weight formula_weight	68321.9 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MTDLTAQEPAWQTRDHLDDPVIGELRNRFGPDAFTVQATRTGVPVVWIKREQLLEVGDFLKKLPKPYVMLFDLHGMDERLRTHREGLPAADFSVFYHLISIDRNRDIMLKVALAENDLHVPTFTKLFPNANWYERETWDLFGITFDGHPNLRRIMMPQTWKGHPLRKDYPARATEFSPFELTKAKQDLEMEALTFKPEEWGMKRGTENEDFMFLNLGPNHPSAHGAFRIVLQLDGEEIVDCVPDIGYHHRGAEKMGERQSWHSYIPYTDRIEYLGGCVNEMPYVLAVEKLAGITVPDRVNVIRVMLSELFRINSHLLYISTFIQDVGAMTPVFFAFTDRQKIYDLVEAITGFRMHPAWFRIGGVAHDLPRGWDRLLREFLDWMPKRLASYEKAALQNTILKGRSQGVAAYGAKEALEWGTTGAGLRATGIDFDVRKARPYSGYENFDFEIPVGGGVSDCYTRVMLKVEELRQSLRILEQCLNNMPEGPFKADHPLTTPPPKERTLQHIETLITHFLQVSWGPVMPANESFQMIEATKGINSYYLTSDGSTMSYRTRVRTPSFAHLQQIPAAIRGSLVSDLIVYLGSIDFVMSDVDR

Entity 5 Entity 5 polymer

Description description	NADH-quinone oxidoreductase subunit B
Molecular weight formula_weight	25081.8 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDYTLTRIDPNGENDRYPLQKQEIVTDPLEQEVNKNVFMGKLNDMVNWGRKNSIWPYNFGLSCCYVEMVTSFTAVHDVARFGAEVLRASPRQADLMVVAGTCFTKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFIPVDVYIPGCPPRPEAYMQALMLLQESIGKERRPLSWVVGDQGVYRANMQSERERKRGERIAVTNLRTPDEI

Entity 6 Entity 6 polymer

Description description	NADH-quinone oxidoreductase subunit I
Molecular weight formula_weight	20562.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGEERCVACNLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDFEMGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP

Entity 7 Entity 7 polymer

Description description	NADH-quinone oxidoreductase subunit H
Molecular weight formula_weight	36240.9 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSWISPELIEILLTILKAVVILLVVVTCGAFMSFGERRLLGLFQNRYGPNRVGWGGSLQLVADMIKMFFKEDWIPKFSDRVIFTLAPMIAFTSLLLAFAIVPVSPGWVVADLNIGILFFLMMAGLAVYAVLFAGWSSNNKYSLLGAMRASAQTLSYEVFLGLSLMGVVAQAGSFNMTDIVNSQAHVWNVIPQFFGFITFAIAGVAVCHRHPFDQPEAEQELADGYHIEYSGMKFGLFFVGEYIGIVTISALMVTLFFGGWQGPLLPPFIWFALKTAFFMMMFILIRASLPRPRYDQVMSFGWKICLPLTLINLLVTAAVILWQAQ

Entity 8 Entity 8 polymer

Description description	NADH-quinone oxidoreductase subunit A
Molecular weight formula_weight	16474.3 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARSKNVPFESGIDSVGSARLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFIFVLLAGLVYLVRIGALDWTPARSRRERMNPETNSIANRQR

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase subunit L
Molecular weight formula_weight	66483.6 kDa
EC 编号 ec_number	1.6.5.11,1.6.5.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MNMLALTIILPLIGFVLLAFSRGRWSENVSAIVGVGSVGLAALVTAFIGVDFFANGEQTYSQPLWTWMSVGDFNIGFNLVLDGLSLTMLSVVTGVGFLIHMYASWYMRGEEGYSRFFAYTNLFIASMVVLVLADNLLLMYLGWEGVGLCSYLLIGFYYTDPKNGAAAMKAFVVTRVGDVFLAFALFILYNELGTLNFREMVELAPAHFADGNNMLMWATLMLLGGAVGKSAQLPLQTWLADAMAGPTPVSALIHAATMVTAGVYLIARTHGLFLMTPEVLHLVGIVGAVTLLLAGFAALVQTDIKRVLAYSTMSQIGYMFLALGVQAWDAAIFHLMTHAFFKALLFLASGSVILACHHEQNIFKMGGLRKSIPLVYLCFLVGGAALSALPLVTAGFFSKDEILAGAMANGHINLMVAGLVGAFMTSLYTFRMIFIVFHGKEQIHAHAVKGVTHSLPLIVLLILSTFVGALIVPPLQGVLPQTTELAHGSMLTLEITSGVVAVVGILLAAWLWLGKRTLVTSIANSAPGRLLGTWWYNAWGFDWLYDKVFVKPFLGIAWLLKRDPLNSMMNIPAVLSRFAGKGLLLSENGYLRWYVASMSIGAVVVLALLMVLR

Entity 10 Entity 10 polymer

Description description	NADH dehydrogenase I subunit M
Molecular weight formula_weight	56560.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MLLPWLILIPFIGGFLCWQTERFGVKVPRWIALITMGLTLALSLQLWLQGGYSLTQSAGIPQWQSEFDMPWIPRFGISIHLAIDGLSLLMVVLTGLLGVLAVLCSWKEIEKYQGFFHLNLMWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQASGLVMLIAILALVFVHYNATGVWTFNYEELLNTPMSSGVEYLLMLGFFIAFAVKMPVVPLHGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFSLPLFPNASAEFAPIAMWLGVIGIFYGAWMAFAQTDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAAGLFILCGQLYERIHTRDMRMMGGLWSKMKWLPALSLFFAVATLGMPGTGNFVGEFMILFGSFQVVPVITVISTFGLVFASVYSLAMLHRAYFGKAKSQIASQELPGMSLRELFMILLLVVLLVLLGFYPQPILDTSHSAIGNIQQWFVNSVTTTRP

Entity 11 Entity 11 polymer

Description description	NADH-quinone oxidoreductase subunit N
Molecular weight formula_weight	52072.7 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MTITPQNLIALLPLLIVGLTVVVVMLSIAWRRNHFLNATLSVIGLNAALVSLWFVGQAGAMDVTPLMRVDGFAMLYTGLVLLASLATCTFAYPWLEGYNDNKDEFYLLVLIAALGGILLANANHLASLFLGIELISLPLFGLVGYAFRQKRSLEASIKYTILSAAASSFLLFGMALVYAQSGDLSFVALGKNLGDGMLNEPLLLAGFGLMIVGLGFKLSLVPFHLWTPDVYQGAPAPVSTFLATASKIAIFGVVMRLFLYAPVGDSEAIRVVLAIIAFASIIFGNLMALSQTNIKRLLGYSSISHLGYLLVALIALQTGEMSMEAVGVYLAGYLFSSLGAFGVVSLMSSPYRGPDADSLFSYRGLFWHRPILAAVMTVMMLSLAGIPMTLGFIGKFYVLAVGVQAHLWWLVGAVVVGSAIGLYYYLRVAVSLYLHAPEQPGRDAPSNWQYSAGGIVVLISALLVLVLGVWPQPLISIVRLAMPLM

Entity 12 Entity 12 polymer

Description description	NADH-quinone oxidoreductase subunit K
Molecular weight formula_weight	10853.0 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MIPLQHGLILAAILFVLGLTGLVIRRNLLFMLIGLEIMINASALAFVVAGSYWGQTDGQVMYILAISLAAAEASIGLALLLQLHRRRQNLNIDSVSEMRG

Entity 13 Entity 13 polymer

Description description	NADH-quinone oxidoreductase subunit J
Molecular weight formula_weight	19889.6 kDa
EC 编号 ec_number	7.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MEFAFYICGLIAILATLRVITHTNPVHALLYLIISLLAISGVFFSLGAYFAGALEIIVYAGAIMVLFVFVVMMLNLGGSEIEQERQWLKPQVWIGPAILSAIMLVVIVYAILGVNDQGIDGTPISAKAVGITLFGPYVLAVELASMLLLAGLVVAFHVGREERAGEVLSNRKDDSAKRKTEEHA

Entity 14 Entity 14 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 15 Entity 15 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 16 Entity 16 non-polymer

Description description	1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE
Molecular weight formula_weight	665.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 18 Entity 18 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	EICOSANE
Molecular weight formula_weight	282.5 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 20 Entity 20 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	11

▼

6. Fold Classification (SCOP + CATH) 11 domains

CATH v4.4 (11 domains)

Domain ID domain_id	7zciA01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	58 — Methane Monooxygenase Hydroxylase; Chain G, domain 1
Homologous superfamily homologous superfamily	1610 — NADH:ubiquinone/plastoquinone oxidoreductase, chain 3

Domain ID domain_id	7zciC01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	460 — Beta Polymerase; domain 2
Homologous superfamily homologous superfamily	80 — NADH:ubiquinone oxidoreductase Nqo5 subunit

Domain ID domain_id	7zciC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	645 — Cytochrome-c3 Hydrogenase; chain B
Homologous superfamily homologous superfamily	10 — Cytochrome-c3 Hydrogenase, chain B

Domain ID domain_id	7zciE01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	1590 — NADH-quinone oxidoreductase subunit E

Domain ID domain_id	7zciE02
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	30 — Glutaredoxin
Homologous superfamily homologous superfamily	10 — Glutaredoxin

Domain ID domain_id	7zciF01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	11540 — NADH-ubiquinone oxidoreductase 51kDa subunit

Domain ID domain_id	7zciF02
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	20 — Ubiquitin-like (UB roll)
Homologous superfamily homologous superfamily	600 —

Domain ID domain_id	7zciF03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	1440 — de novo design (two linked rop proteins)
Homologous superfamily homologous superfamily	230 — NADH-ubiquinone oxidoreductase 51kDa subunit, iron-sulphur binding domain

Domain ID domain_id	7zciG01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	40 — Barwin-like endoglucanases
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	7zciJ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	1200 — NADH-ubiquinone/plastoquinone oxidoreductase chain 6, subunit NuoJ

Domain ID domain_id	7zciK01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	3510 —

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.69 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	189796

Complex I from E. coli, LMNG-purified, under Turnover at pH 6, Resting state

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-quinone oxidoreductase subunit F

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase I subunit E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit C/D

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit I

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit H

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-quinone oxidoreductase subunit A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase subunit L

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase I subunit M

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer