8a3t

S. cerevisiae APC/C-Cdh1 complex

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit CDC27

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC27_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain F； PDBConstruct 1–758； UniProt 1–758 Author chain H； PDBConstruct 1–758； UniProt 1–758

Anaphase-promoting complex subunit CDC16

Saccharomyces cerevisiae

UniProt P09798

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC16_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain J； PDBConstruct 1–840； UniProt 1–840 Author chain K； PDBConstruct 1–840； UniProt 1–840

Anaphase-promoting complex subunit CDC26

Saccharomyces cerevisiae

UniProt P14724

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC26_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–124； UniProt 1–124 Author chain W； PDBConstruct 1–124； UniProt 1–124

Anaphase-promoting complex subunit 9

Saccharomyces cerevisiae

UniProt Q12107

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC9_YEAST
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 1–265； UniProt 1–265

Anaphase-promoting complex subunit DOC1

Saccharomyces cerevisiae

UniProt P53068

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC10_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain A； PDBConstruct 1–250； UniProt 1–250

CDH1 isoform 1

Saccharomyces cerevisiae

UniProt A0A6A5PYD7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PYD7_YEASX
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain B； PDBConstruct 1–566； UniProt 1–566

HSL1 isoform 1

Saccharomyces cerevisiae

UniProt A0A8H4BYV4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8H4BYV4_YEASX
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain S； PDBConstruct 1–1518； UniProt 1–1518

Anaphase-promoting complex subunit 1

Saccharomyces cerevisiae

UniProt P53886

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC1_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain C； PDBConstruct 1–1748； UniProt 1–1748

Anaphase-promoting complex subunit 5

Saccharomyces cerevisiae

UniProt Q08683

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC5_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain O； PDBConstruct 1–685； UniProt 1–685

Anaphase-promoting complex subunit CDC23

Saccharomyces cerevisiae

UniProt P16522

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CDC23_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–626； UniProt 1–626 Author chain P； PDBConstruct 1–626； UniProt 1–626

Anaphase-promoting complex subunit SWM1

Saccharomyces cerevisiae

UniProt Q12379

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SWM1_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain I； PDBConstruct 1–170； UniProt 1–170

Anaphase-promoting complex subunit MND2

Saccharomyces cerevisiae

UniProt P40577

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MND2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain N； PDBConstruct 1–368； UniProt 1–368

Anaphase-promoting complex subunit 4

Saccharomyces cerevisiae

UniProt Q04601

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 2 × 1 （Q12440） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC4_YEAST
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–652； UniProt 1–652

Anaphase-promoting complex subunit 2

Saccharomyces cerevisiae

UniProt Q12440

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 11 × 1 （Q12157） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC2_YEAST
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain T； PDBConstruct 1–853； UniProt 1–853

Anaphase-promoting complex subunit 11

Saccharomyces cerevisiae

UniProt Q12157

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 19	Anaphase-promoting complex subunit CDC27 × 2 （P38042） Anaphase-promoting complex subunit CDC16 × 2 （P09798） Anaphase-promoting complex subunit CDC26 × 2 （P14724） Anaphase-promoting complex subunit 9 × 1 （Q12107） Anaphase-promoting complex subunit DOC1 × 1 （P53068） CDH1 isoform 1 × 1 （A0A6A5PYD7） HSL1 isoform 1 × 1 （A0A8H4BYV4） Anaphase-promoting complex subunit 1 × 1 （P53886） Anaphase-promoting complex subunit 5 × 1 （Q08683） Anaphase-promoting complex subunit CDC23 × 2 （P16522） Anaphase-promoting complex subunit SWM1 × 1 （Q12379） Anaphase-promoting complex subunit MND2 × 1 （P40577） Anaphase-promoting complex subunit 4 × 1 （Q04601） Anaphase-promoting complex subunit 2 × 1 （Q12440） ZINC ION × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	APC11_YEAST
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain U； PDBConstruct 1–165； UniProt 1–165

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8a3t
Deposition date deposition_date	2022-06-09
Structure title title	S. cerevisiae APC/C-Cdh1 complex
Keywords keywords	APC/C, ubiqutiniation, D-box, Cdh1, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8a3t__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8a3t__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8a3t__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	71.38 Å
Rg (electron density)	71.21 Å
Total Rg	71.31 Å
Atom count	61351
Residues	7661
Excluded volume	1099700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8a3t__assembly_1__model_1`	nonadecameric （19）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (16)

Entity 1 Entity 1 polymer

Description description	Anaphase-promoting complex subunit CDC27
Molecular weight formula_weight	85487.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,H
Atom count atom_count	61351

MAVNPELAPFTLSRGIPSFDDQALSTIIQLQDCIQQAIQQLNYSTAEFLAELLYAECSILDKSSVYWSDAVYLYALSLFLNKSYHTAFQISKEFKEYHLGIAYIFGRCALQLSQGVNEAILTLLSIINVFSSNSSNTRINMVLNSNLVHIPDLATLNCLLGNLYMKLDHSKEGAFYHSEALAINPYLWESYEAICKMRATVDLKRVFFDIAGKKSNSHNNNAASSFPSTSLSHFEPRSQPSLYSKTNKNGNNNINNNVNTLFQSSNSPPSTSASSFSSIQHFSRSQQQQANTSIRTCQNKNTQTPKNPAINSKTSSALPNNISMNLVSPSSKQPTISSLAKVYNRNKLLTTPPSKLLNNDRNHQNNNNNNNNNNNNNNNNNNNNNNNNIINKTTFKTPRNLYSSTGRLTTSKKNPRSLIISNSILTSDYSITLPEIMYNFALILRSSSQYNSFKAIRLFESQIPSHIKDTMPWCLVQLGKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKSSNLANGLMDTMPNKPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPTSSLSKYKMGQLLYSMTRYNVALQTFEELVKLVPDDATAHYLLGQTYRIVGRKKDAIKELTVAMNLDPKGNQVIIDELQKCHMQE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Anaphase-promoting complex subunit CDC16
Molecular weight formula_weight	96282.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,K

MKFCLYCCHCYIVICGKATHYYKSSKATSNLKSSNRVLMRNPMSPSEQHSQHNSTLAASPFVSNVSAARTQQSLPTDAQNDRLQQPWNRTNTATSPYQSLANSPLIQKLQANIMTPHQPSANSNSNSNSITGNVVNDNNLLASMSKNSMFGSTIPSTLRKVSLQREYKDSVDGVVRDEDNDEDVHNNGDAAANANNDRESKLGHNGPLTTTTLTTTTTATQLDVSELSAIERLRLWRFDALMQHMYRTAEYIADKVYNISNDPDDAFWLGQVYYNNNQYVRAVELITRNNLDGVNILCRYLLGLSFVKLQRFDDALDVIGEYNPFSEDPSTTAANTMSNNGNNSNTSQPVTDGGIKMESSLCFLRGKIYFAQNNFNKARDAFREAILVDIKNFEAFEMLLSKNLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKYINTEDITKSNEILAKDYKLADNVDVVRSKVDICYTQCKFNECLELCETVLENDEFNTNILPAYIGCLYELSNKNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFAHTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPNDPLVLNEMGVMYFKKNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKLNENEIAIKCFRCVLEKNDKNSEIHCSLGYLYLKTKKLQKAIDHLHKSLYLKPNNSSATALLKNALELNVTLSLDASHPLIDKSNLMSQASKDKASLNKKRSSLTYDPVNMAKRLRTQKEIFDQNNKALRKGGHDSKTGSNNADDDFDADMELEKSSIPENLYF

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Anaphase-promoting complex subunit CDC26
Molecular weight formula_weight	14096.9 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,W

MIRRAPTTLQLSHDDVTSLIDDLNEQKLKQQLNIEKTKYFQGKNGGSLHSNTDFQDTSQNIEDNNNDNDNDIDEDDDMSSYNDKAASVAHTRVLNSLHLSTDSNTAHETSNANDNHNPFYIREE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Anaphase-promoting complex subunit 9
Molecular weight formula_weight	30901.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MNQNGDKNEGKLFQLPSLPPWKTPRFNKANFNNFTTPLRKRSTRVINDDSMPITGEVLEERTADDLYGINMDVDEVDYLNTLSHIEEEKQYDYSPFCERNTLRESRIDSFLKAERAAHCLVFHKVGHLDGIDSYRPDIDIMCGEEANKYDSANPEGNGSMLLESVPGCNKEDLERLSRREFVTNSKPNMRRLDDIINHETNALKSFWNDSGLVNSLQSHHLHEEYLLLQEELKNVYKIKCHDRVPIESLRDKCRRHYSNEDSSFL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	Anaphase-promoting complex subunit DOC1
Molecular weight formula_weight	28810.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MDPIGINKVLDHLAPSELIKPVKSCHNKPSVLVLDDRIVDAATKDLYVNGFQEEIQYQNPTPENLQHMFHQGIEILDSARMINVTHLALWKPSSFKLGNPVDFALDDNYDTFWQSDGGQPHQLDIMFSKRMDICVMAIFFSMIADESYAPSLVKVYAGHSPSDARFYKMLEVRNVNGWVALRFLDNREDDQLLKCQFIRLLFPVNHENGKDTHLRGIRLYVPSNEPHQDTHEWAQTLPETNNVFQDAILR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	CDH1 isoform 1
Molecular weight formula_weight	62903.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSTNLNPFMNNTPSSSPLKGSESKRVSKRPISSSSSASLLSSPSRRSRPSTVYGDRYIPSRTDIDFNSIVSISSMASVPALNPSSTEDQVEYQKERQAHETYNTLLKNELFGEMLSKDTVGSESSIDRIKNTRPSTRGNVHAENTTRHGYELERVSTPPPEAAGLEEFSPHSTPVTPRRLFTSQQDEITRPSSNSVRGASLLTYQQRKGRRLSAASLLQSQFFDSMSPVRPDSKQLLLSPGKQFRQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCDTENEYTSLSWIGAGSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDRVACLSWNNHVLTSGSRDHRILHRDVRMPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTSKSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNELVTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKPKAKVQPNSLIFDAFNQIR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	HSL1 isoform 1
Molecular weight formula_weight	169861.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MTGHVSKTSHVPKGRPSSLAKKAAKRAMAKVNSNPKRASGHLERVVQSVNDATKRLSQPDSTVSVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSNLSSEARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYKQRHSISLSSSSENKKSATESSVNEPRIEYASKTANNTGLRSENNDVKTLHSLEIHSEDTSTVNQNNAITGVNTEINAPVLAQKSQFSINTLSQPESDKAEAEAVTLPPAIPIFNASSSRIFRNSYTSISSRSRRSLRLSNSRLSLSASTSRETVHDNEMPLPQLPKSPSRYSLSRRAIHASPSTKSIHKSLSRKNIAATVAARRTLQNSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKKPASENVNKSEPHSLESDSDFEILCDQILFGNALDRILEEEEDNEKERDTQRQRQNDTKSSADTFTISGVSTNKENEGPEYPTKIEKNQFNMSYKPSENMSGLSSFPIFEKENTLSSSYLEEQKPKRAALSDITNSFNKMNKQEGMRIEKKIQREQLQKKNDRPSPLKPIQHQELRVNSLPNDQGKPSLSLDPRRNISQPVNSKVESLLQGLKFKKEPASHWTHERGSLFMSEHVEDEKPVKASDVSIESSYVPLTTVATSSRDPSVLAESSTIQKPMLSLPSSFLNTSMTFKNLSQILADDGDDKHLSVPQNQSRSVAMSHPLRKQSAKISLTPRSNLNANLSVKRNQGSPGSYLSNDLDGISDMTFAMEIPTNTFTAQAIQLMNNDTDNNKINTSPKASSFTKEKVIKSAAYISKEKEPDNSDTNYIPDYTIPNTYDEKAINIFEDAPSDEGSLNTSSSESDSRASVHRKAVSIDTMATTNVLTPATNVRVSLYWNNNSSGIPRETTEEILSKLRLSPENPSNTHMQKRFSSTRGSRDSNALGISQSLQSMFKDLEEDQDGHTSQADILESSMSYSKRRPSEESVNPKQRVTMLFDEEEEESKKVGGGKIKEEHTKLDNKISEESSQLVLPVVEKKENANNTENNYSKIPKPSTIKVTKDTAMESNTQTHTKKPILKSVQNVEVEEAPSSDKKNWFVKLFQNFSSHNNATKASKNHVTNISFDDAHMLTLNEFNKNSIDYQLKNLDHKFGRKVVEYDCKFVKGNFKFKIKITSTPNASTVITVKKRSKHSNTSSNKAFEKFNDDVERVIRNAGRS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	Anaphase-promoting complex subunit 1
Molecular weight formula_weight	196372.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MTSKPSTRNDYLPRETHNGEYTGDSPEWQLQINITNKIGGINGDIWLSRDGRSVKWCIEDQCLRQFTYNQKIIKAGYIDFEKTPDCFVVVLSDIAHVYMLKNGGSTTVCFPFQIGNAFWYANGVILERETSASFMDGGYDLKPIEFDLKHKYITLTDPMAPFGLISITNTFKGGINSASGNKTDILQDFQLVLFPSDKDKCIAVFLDRNSKVLRFYYSRILSSDQSRKGELTISSTKKTGLDAAGNSQKSGGISKDLRKFSHLTRRSTSINSNSHDFNAAERVLSGNVGNASGRTDIFALPSSCSRRSLSATLDRMGNNIAPTNRAAPSGFFDSSSANTATHSNITPVSQPMQQQQQEYLNQTATSSKDIVLTEISSLKLPDDIIFTSRRLSSILSKLKFLSLRFERREGLLIFHEPTHFCKIWLIDLLPDVLDSIPFKIYGNSPQNMIRLENLKLKEPSRIQAMYIHELLESCLILVSEGQNKEEYKACLYDPFVKITSPSKNISEELTKQNSLPSLQKLFPYPETSFTKLCFEAVKYITSPAFNISFIFLWQSAYSILLSRANDDVVGGLKMEHDAFSLVLSLLILPIPSSSAQEYQEYKEIYERDLFQHLKQDSEITSSVLPRIVIGLHLIREEYSLNVLCRNEHALLGQFLRFATAAMGWPDLWQSYYVPKMDSESKTFLHPREQNSTFFHPLDEPPSITKSLYSITENSSIPLCPFISFSRLVATDTQVELRITPRSFKILGLYELVHSPNFLPDYVLGILSSFKVDKDELQTYPLGILVPLQNILKILEDKLSEVRDNLELLDRADLQRCSAIINSIRSDSKEVLKRGQRDSYMLCKVPLAKNRSSLSKKPSDIYSILSEIVKSASQVPLDGSAMRMSNIQDDEDIDEGRSLKLNAGLIFSEDKRFTHVVSLLAYYRPTKTQFFTTKTEYAQILAQKKYFAKIMALRTCTNGVGWGAVAYATEKPISTQKWVIQPLNLISVFPDDTKITVKAPEDIAHDIVEWGQFHAGVSSGLRISKKATGITGSWIAFNKPKELDAYHGGFLLGLGLNGHLKNLEEWHIYNYLSPRNTHISIGLLLGMSSSMKGSMDSKLIKVISVHLVAFLPSGSSDLNIDLKLQTAGIIGMGMLYLNSRHKRMSDSIFAQLVSLLNVNDEMVADEEYRLAAGISLGLINLGAGQTKLRKWDSSLLGLGDDLPEDVYDSSDVEQNVMYEDLTTKLLEIVTSTYDVENDWIPENSQIGAVIAIMFLFLKSNNFGISNMLKVDLKEILKANINTRPELLMYREWASNMILWEFIGDDLSFIMKDVDIGVKFSELNTDLLPIYYTMAGRILAMGIRFASTGNLKIRNILLSLVDKFLPLYQYPGKQNLDFRLTISVINVLTNVIVVSLSMVMCASGDLEVLRRVKYLHEVASGPYSDLFQEIPSSKSDVSGVTQVTSNTNTPGNSDRERVDETAASLDDERSSNGSDISDPTAYLEDKKDIDDHYGKFISTNLALGFLFLGSGQYALNTSTLESIAFLSMSVLPTYTTPHPLQELKHFWSMAVEPRCLVIKDISTGDAVNNVPIELVVEEDVEKEEVIREISTPCLLPDFSKIKSIRVKMHGYFPLEVNFTKDYSASDFFSGGTIIYIQRKSESVFENKASFRNVEDIHVALKRKAAESKNYSRLNLKNEQGNTTSSQLVESLGIQDLTMVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWYKSFGPHDE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 polymer

Description description	Anaphase-promoting complex subunit 5
Molecular weight formula_weight	79355.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSKYGPLGITNFITPYDLCILILIHAHCSQDNGISVPTAVFLRLISPTRPSLEWNPLLKDNSNLRSSSIVPPPVLPILDNIIRILLDDKDGNKIALTLMGYLEAINGLDSINRLMMDLEKNCLVNNYRSMKMRTTSTRRQMTRASFLGTFLSTCIRKYQIGDFEMRETIWINLQNFKTVFKHTPLWLRFKDNVHIQKVKNCLLANDEISVEDQQMVEFFQHFNNGNDADSKTMNEENYGTLISIQHLQSIVNRQIVNWLDNTEFNLMGQEETSSTYEEQSGLVFDLLDTLSLNDATKFPLIFILKYLEAIKENSYQTALDSLHNYFDYKSTGNSQNYFHISLLSLATFHSSFNECDAAINSFEEATRIARENKDMETLNLIMIWIINFIEVHPEYANRFYITVEQIIKYLKNSSDVEDANIFSNAYKFETLLSMVKESKTAEVSSSLLKFMAITLQNVPSQNFDLFQSLVSYEVKFWKELGYESISDVYEKFLSKTSSSSLRNYDSSIINQDIKVAFKALEEDDFLKVKQYLLKSESLELDYDQKINLKYLRVKYLVKIGDYDLSMRLINQYVKECCEEVADSNWRFKFEIESINVLLLSDVGIRSLPKIIKLIDEYKEIGNPLRCVILLLKLCEVLIQVGKSMEAECLISCNLSTILEFPFVRKKTDELLESLSVEEDRDVQMT

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 10 Entity 10 polymer

Description description	Anaphase-promoting complex subunit CDC23
Molecular weight formula_weight	73198.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,P

MNDDSQDKIIHDIRIQLRKAATELSRWKLYGSSKWAAEALAGLAEAIDVDQTHSLADESPLRNKQGVPKQMFEIPQNGFGLSETEYDLYLLGSTLFDAKEFDRCVFFLKDVTNPYLKFLKLYSKFLSWDKKSQESMENILTTGKFTDEMYRANKDGDGSGNEDINQSGHQRANLKMVSNEHESQSNISSILKEINTFLESYEIKIDDDEADLGLALLYYLRGVILKQEKNISKAMSSFLKSLSCYSFNWSCWLELMDCLQKVDDALLLNNYLYQNFQFKFSENLGSQRTIEFNIMIKFFKLKVFEELNGQLEDYFEDLEFLLQVFPNFTFLKAYNATISYNNLDYVTAESRFDDIVKQDPYRLNDLETYSNILYVMQKNSKLAYLAQFVSQIDRFRPETCCIIANYYSARQEHEKSIMYFRRALTLDKKTTNAWTLMGHEFVELSNSHAAIECYRRAVDICPRDFKAWFGLGQAYALLDMHLYSLYYFQKACTLKPWDRRIWQVLGECYSKTGNKVEAIKCYKRSIKASQTVDQNTSIYYRLAQLYEELEDLQECKKFMMKCVDVEELLEGIVTDETVKARLWLAIFEIKAGNYQLAYDYAMGVSSGTSQEIEEARMLARECRRHM

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 11 Entity 11 polymer

Description description	Anaphase-promoting complex subunit SWM1
Molecular weight formula_weight	19377.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MSSSSYRDSYFQYRHLPAPHHILYAEWNQDILALPDEVANITMAMKDNTRTDAEEGRAPQDGERNSNVRESAQGKALMTSEQNSNRYWNSFHDEDDWNLFNGMELESNGVVTFAGQAFDHSLNGGTNSRNDGANEPRKETITGSIFDRRITQLAYARNNGWHELALPQSR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 12 Entity 12 polymer

Description description	Anaphase-promoting complex subunit MND2
Molecular weight formula_weight	42881.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MARALRDISLFNDIRKDQNSAGAKHERYNMRDLRSKKNQHVNGIDDYEDDSLDRFIRRKKSRVVKYIPSLSAYNVFNEFPYYPTSASQLLDGKLDEFLMLSEQYKSRLPKIRKLGWNRFKPIGINKTMYELEMLRSRARAQNAEGNNEEDFRQHDSREEDPRNNGSIGRVILPHILQENEEYDTGEGVTGLHSMPNDSMAILANNSANNSQNEEVSEEDEISYDYDAEFDHVVDEDDNEEGEVPGEGVEGIEVQRERIVPDDLLMRPTSLSRSLQQFVEEAHHLDRNPYDIDSDNDGEDSKVELDMNPDFEDDVGREHDYNSEYSQEPTSYGGITPDLASNWRNWTRERITSLDELMERRARQQRGQD

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	Anaphase-promoting complex subunit 4
Molecular weight formula_weight	75345.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MSSPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDLPKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHILVDLKTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGTLKDENLGIISKESSVKIPALFKSYRLSSTRFVPNRVHSLLRDIGLSDSNYHSSHVTDYRGENYENEEDDGTIAIPAYIRENRENDDFIACTAKVSVDGRSASLVFPKEKQNV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 14 Entity 14 polymer

Description description	Anaphase-promoting complex subunit 2
Molecular weight formula_weight	100099.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MSFQITPTRDLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPNNATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDDFDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQYWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIMKDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVKPYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDINQDTNITKRDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNIKSSYIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTETSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIFPKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEIQLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQKGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIVKNGHKNS

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 15 Entity 15 polymer

Description description	Anaphase-promoting complex subunit 11
Molecular weight formula_weight	18887.1 kDa
EC 编号 ec_number	6.3.2.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGDQCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSRRREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;baker's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 16 Entity 16 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	8a3tA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	260 — Galactose-binding domain-like

Domain ID domain_id	8a3tD01
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	10 — Tetratricopeptide repeat domain

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	249193

S. cerevisiae APC/C-Cdh1 complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Anaphase-promoting complex subunit CDC27

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit CDC16

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit CDC26

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit DOC1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CDH1 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HSL1 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit CDC23

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer