SAXSdb — 8a8q

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein scalloped

Drosophila melanogaster

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Isoform 7 of Transcriptional coactivator YAP1 × 2 （P46937） ACETATE ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SCAL_DROME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–219； UniProt 222–440 Author chain B； PDBConstruct 1–219； UniProt 222–440

Isoform 7 of Transcriptional coactivator YAP1

OrganismNot specified

UniProt P46937

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Protein scalloped × 2 （P30052） ACETATE ION × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	YAP1_HUMAN
Isoform	P46937-7
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 2–50； UniProt 51–99 Author chain D； PDBConstruct 2–50； UniProt 51–99

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8a8q
Deposition date deposition_date	2022-06-23
Structure title title	Crystal structure of Protein Scalloped in complex with YAP peptide
Keywords keywords	Complex, TRANSCRIPTION; TRANSCRIPTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8a8q__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8a8q__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8a8q__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	26.38 Å
Rg (electron density)	25.52 Å
Total Rg	26.31 Å
Atom count	3964
Residues	487
Excluded volume	71110 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8a8q__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Protein scalloped
Molecular weight formula_weight	25757.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4211

GRAIATHKFRLLEFTAFMEIQRDEIYHRHLFVQLGGKPSFSDPLLETVDIRQIFDKFPEKSGGLKDLYEKGPQNAFYLVKCWADLNTDLTTGSETGDFYGVTSQYESNENVVLVCSTIVCSFGKQVVEXVESEYSRLENNRYVYRIQRSPMCEYMINFIQKLKNLPERYMMNSVLENFTILQVMRARETQETLLCIAYVFEVAAQNSGTTHHIYRLIKE

Source Source

Source organism organism	Drosophila melanogaster
Common name common_name	fruit fly
NCBI taxonomy ID ncbi_taxonomy_id	7227
Host organism host_organism	;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ;

Entity 2 Entity 2 polymer

Description description	Isoform 7 of Transcriptional coactivator YAP1
Molecular weight formula_weight	5496.3 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

XGHQIVHVRGDSETDLEALFNAVLNPKTANVPQTVPLRLRKLPDSFFKPPX

Entity 3 Entity 3 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	235

▶

Unit-cell length a length_a	42.772 Å
Unit-cell length b length_b	85.700 Å
Unit-cell length c length_c	76.227 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.62 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.465 Å
Low-resolution limit resolution_low	29.090 Å
R factor r_factor	0.2119
R_work r_work	0.2108
R_free r_free	0.2337

Crystal structure of Protein Scalloped in complex with YAP peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein scalloped

State in the Current Structure

Other States of the Same Protein in the Database

Isoform 7 of Transcriptional coactivator YAP1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8a8q__assembly_1__model_1

8a8q__assembly_1__model_1 | I(q)

8a8q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of Protein Scalloped in complex with YAP peptide

1. Protein Identity and Related Structures Protein Identity & Related Structures

Protein scalloped

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Isoform 7 of Transcriptional coactivator YAP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8a8q__assembly_1__model_1

8a8q__assembly_1__model_1 | I(q)

8a8q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)