SAXSdb — 8ah1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein VP1

Betapolyomavirus hominis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 5	CHLORIDE ION × 5 GLYCEROL × 3 water × 5	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 5	CHLORIDE ION × 5 GLYCEROL × 7 water × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VP1_POVBK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 1–271； UniProt 31–301 Author chain BBB； PDBConstruct 1–271； UniProt 31–301 Author chain CCC； PDBConstruct 1–271； UniProt 31–301 Author chain DDD； PDBConstruct 1–271； UniProt 31–301 Author chain EEE； PDBConstruct 1–271； UniProt 31–301 Author chain FFF； PDBConstruct 1–271； UniProt 31–301 Author chain GGG； PDBConstruct 1–271； UniProt 31–301 Author chain HHH； PDBConstruct 1–271； UniProt 31–301 Author chain III； PDBConstruct 1–271； UniProt 31–301 Author chain JJJ； PDBConstruct 1–271； UniProt 31–301

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ah1
Deposition date deposition_date	2022-07-20
Structure title title	BK Polyomavirus VP1 mutant N-Q
Keywords keywords	Patient-derived VP1 mutant, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ah1__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ah1__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ah1__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.25 Å
Rg (electron density)	31.97 Å
Total Rg	32.74 Å
Atom count	9904
Residues	1301
Excluded volume	174720 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ah1__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8ah1__assembly_2__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Major capsid protein VP1
Molecular weight formula_weight	29785.4 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AAA,BBB,CCC,DDD,EEE,FFF,GGG,HHH,III,JJJ
Atom count atom_count	20804

GGVEVLEVKTGVDAITEVECFLNPEMGDPDENLRGFSLNLSAENDFSSDSPQRKMLPCYSTARIPLPNLNEDLTSGNLLMWEAVTVQTEVIGITSMLNLHAGSQKVHEHGGGKPIQGSNFHFFAVGGEPLEMQGVLMNYRSKYPDGTITPKNPTAQSQVMNTDHKAYLDKNNAYPVECWVPDPSRNENARYFGTFTGGENVPPVLHVTNTATTVLLDEQGVGPLCKADSLYVSAADICGLFTNSSGTQQWRGLARYFKIRLRKRSVKNPYP

Source Source

Source organism organism	Betapolyomavirus hominis
NCBI taxonomy ID ncbi_taxonomy_id	1891762
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1023

▶

Unit-cell length a length_a	60.462 Å
Unit-cell length b length_b	155.959 Å
Unit-cell length c length_c	141.322 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	92.64 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	20

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.006 Å
Low-resolution limit resolution_low	48.784 Å
R factor r_factor	—
R_work r_work	0.1800
R_free r_free	0.2320

BK Polyomavirus VP1 mutant N-Q

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ah1__assembly_2__model_1

8ah1__assembly_2__model_1 | I(q)

8ah1__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

BK Polyomavirus VP1 mutant N-Q

1. Protein Identity and Related Structures Protein Identity & Related Structures

Major capsid protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8ah1__assembly_2__model_1

8ah1__assembly_2__model_1 | I(q)

8ah1__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)