SAXSdb — 8b2r

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disease resistance protein RGA5

Oryza sativa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	AVR-Pik protein × 1 （C4B8B8） SULFATE ION × 1 CHLORIDE ION × 2 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RGA5R_ORYSJ
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 4–78； UniProt 997–1071

AVR-Pik protein

Pyricularia oryzae

UniProt C4B8B8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Disease resistance protein RGA5 × 1 （F7J0N2） SULFATE ION × 1 CHLORIDE ION × 2 1,2-ETHANEDIOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C4B8B8_MAGOR
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 4–86； UniProt 31–113

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8b2r
Deposition date deposition_date	2022-09-14
Structure title title	Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikF with a rice (Oryza sativa) RGA5 HMA domain mutant.
Keywords keywords	;heavy-metal associated domain, plant immunity, fungal pathogen, Magnaporthe oryzae, rice blast, rice, NLR, MAX effector, ANTIFUNGAL PROTEIN ;; ANTIFUNGAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8b2r__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8b2r__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8b2r__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.01 Å
Rg (electron density)	15.79 Å
Total Rg	16.97 Å
Atom count	2592
Residues	164
Excluded volume	23042 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8b2r__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Disease resistance protein RGA5
Molecular weight formula_weight	8409.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2863

GPMRTKIVVKVHMPCGKSRAKAMALAASVNGVDSVEITGDDKDRLQVVGRGIDPVRLVALLREKCGLAELLQVEEVKE

Source Source

Source organism organism	Oryza sativa
Common name common_name	Asian cultivated rice
NCBI taxonomy ID ncbi_taxonomy_id	4530
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	AVR-Pik protein
Molecular weight formula_weight	9922.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GPMRAIDLSRERDPNFFDNADIPVPECFWFMFKNNVRQDAGTCYSSWKMDKKVGPNWVHIKSDDNCNLSGDFPPGWIVLGKKRPGF

Source Source

Source organism organism	Pyricularia oryzae
NCBI taxonomy ID ncbi_taxonomy_id	318829
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	180

▶

Unit-cell length a length_a	31.906 Å
Unit-cell length b length_b	57.896 Å
Unit-cell length c length_c	76.657 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.220 Å
Low-resolution limit resolution_low	46.242 Å
R factor r_factor	—
R_work r_work	0.1502
R_free r_free	0.2037

Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikF with a rice (Oryza sativa) RGA5 HMA domain mutant.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disease resistance protein RGA5

State in the Current Structure

Other States of the Same Protein in the Database

AVR-Pik protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8b2r__assembly_1__model_1

8b2r__assembly_1__model_1 | I(q)

8b2r__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Complex of rice blast (Magnaporthe oryzae) effector protein AVR-PikF with a rice (Oryza sativa) RGA5 HMA domain mutant.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disease resistance protein RGA5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

AVR-Pik protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8b2r__assembly_1__model_1

8b2r__assembly_1__model_1 | I(q)

8b2r__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)