SAXSdb — 8b9f

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Complement decay-accelerating factor

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Genome polyprotein × 1 （A0A6M5CIM5） Genome polyprotein × 1 （A0A7T7IN41） Genome polyprotein × 1 （A0A6M5CIM5） SPHINGOSINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DAF_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain E； PDBConstruct 8–259； UniProt 34–285

Genome polyprotein

Echovirus E11

UniProt A0A6M5CIM5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Complement decay-accelerating factor × 1 （P08174） Genome polyprotein × 1 （A0A7T7IN41） SPHINGOSINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6M5CIM5_9ENTO
Isoform	—
PDB entities	2, 4
Chains and sequence ranges	Author chain B； PDBConstruct 1–262； UniProt 70–331 Author chain A； PDBConstruct 1–287； UniProt 570–856

Genome polyprotein

Echovirus E11

UniProt A0A7T7IN41

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Complement decay-accelerating factor × 1 （P08174） Genome polyprotein × 1 （A0A6M5CIM5） Genome polyprotein × 1 （A0A6M5CIM5） SPHINGOSINE × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7T7IN41_9ENTO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–238； UniProt 332–569

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8b9f
Deposition date deposition_date	2022-10-05
Structure title title	Structure of Echovirus 11 complexed with DAF (CD55) calculated from symmetry expansion
Keywords keywords	Echovirus, receptor, CD55, DAF, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8b9f__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8b9f__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8b9f__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	35.85 Å
Rg (electron density)	36.79 Å
Total Rg	36.83 Å
Atom count	5533
Residues	708
Excluded volume	98447 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8b9f__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Complement decay-accelerating factor
Molecular weight formula_weight	29771.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E
Atom count atom_count	5533

MGCVAETGDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGGTKHHHHHH

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	28886.4 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

SPSAEECGYSDRVRSITLGNSTITTQECANVVVAYGRWPEYLSDKEATAEDQPTQPDVATCRFYTLESVTWEKDSPGWWWKFPDALKDMGLFGQNMYYHYLGRAGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSDVGGTVNEHAISEGEIAKKFSATATNGAHTVQSIVTNAGMGVGVGNLTIYPHQWVNLRTNNSATIVMPYINSVPMDNMFRHHNFTLMIIPFVSLDYSSDASTYVPITVTVAPMCAEYNGLRLATSLQ

Source Source

Source organism organism	Echovirus E11
NCBI taxonomy ID ncbi_taxonomy_id	12078
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	26029.7 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GLPVMNTPGSNQFLTSDDFQSPSAMPQFDVTPELDIPGEVKNLMEIAEVDSVVPVNNVVGKLDTMDIFRIPVQSGNHQSTQVFGFQVQPGLDSVFKHTLLGEILNYYAHWSGSVKLTFVFCGSAMATGKFLLAYSPPGANAPKTRKDAMLGTHVIWDVGLQSSCVLCIPWISQTHYRLVHQDEYTSAGNVTCWYQTGIVVPAGTPTLCSIMCFVSACNDFSVRLLKDTPFIEQSALLQ

Source Source

Source organism organism	Echovirus E11
NCBI taxonomy ID ncbi_taxonomy_id	12078
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	32284.3 kDa
EC 编号 ec_number	3.4.22.29,3.6.1.15,3.4.22.28,2.7.7.48
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

GDVVEAIEGAVARVADTISSGPTNSQAVPALTAVETGHTSQVVPGDTMQTRHVKNYHSRSESTIENFLSRSACVYMGEYYTTNTDETKRFASWTINARRMVQMRRKLEMFTYVRFDVEVTFVITSKQDQGTQLGQDMPPLTHQIMYIPPGGPIPKSTTDYAWQTSTNPSIFWTEGNAPPRMSIPFVSIGNAYSNFYDGWSHFSQNGVYGYNTLNNMGQLYMRHVNGPSPLPMTSIVRVYFKPKHVKAWVPRPPRLCQYKNASTVNFSSTNITDKRDSITHVPDTVKP

Source Source

Source organism organism	Echovirus E11
NCBI taxonomy ID ncbi_taxonomy_id	12078
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 non-polymer

Description description	SPHINGOSINE
Molecular weight formula_weight	299.5 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	8b9fE01
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

Domain ID domain_id	8b9fE02
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	70 — Complement Module; domain 1
Homologous superfamily homologous superfamily	10 — Complement Module, domain 1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.93 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	201358

Structure of Echovirus 11 complexed with DAF (CD55) calculated from symmetry expansion

1. Protein Identity and Related Structures Protein Identity & Related Structures

Complement decay-accelerating factor

State in the Current Structure

Other States of the Same Protein in the Database

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8b9f__assembly_1__model_1

8b9f__assembly_1__model_1 | I(q)

8b9f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)

Structure of Echovirus 11 complexed with DAF (CD55) calculated from symmetry expansion

1. Protein Identity and Related Structures Protein Identity & Related Structures

Complement decay-accelerating factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Genome polyprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8b9f__assembly_1__model_1

8b9f__assembly_1__model_1 | I(q)

8b9f__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (1)