8bd7

IFTB1 subcomplex of anterograde Intraflagellar transport trains (Chlamydomonas reinhardtii)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

IFT88

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JCJ2_CHLRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–782； UniProt 1–782 Author chain H； PDBConstruct 1–782； UniProt 1–782

Osm-6-like protein

OrganismNot specified

UniProt Q946G4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q946G4_CHLRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–454； UniProt 1–454 Author chain J； PDBConstruct 1–454； UniProt 1–454

IFT70

OrganismNot specified

UniProt A8ITN7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8ITN7_CHLRE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–647； UniProt 1–647 Author chain K； PDBConstruct 1–647； UniProt 1–647

Intraflagellar transport protein 46

OrganismNot specified

UniProt A2T2X4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IFT46_CHLRE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–344； UniProt 1–344 Author chain N； PDBConstruct 1–344； UniProt 1–344

Intraflagellar transport protein 56

OrganismNot specified

UniProt A8JA42

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IFT56_CHLRE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–555； UniProt 1–555 Author chain O； PDBConstruct 1–555； UniProt 1–555

Intraflagellar transport protein 81

OrganismNot specified

UniProt Q68RJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IFT81_CHLRE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–683； UniProt 1–683 Author chain P； PDBConstruct 1–683； UniProt 1–683

Intraflagellar transport protein 74

OrganismNot specified

UniProt Q6RCE1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IFT74_CHLRE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–641； UniProt 1–641 Author chain Q； PDBConstruct 1–641； UniProt 1–641

Intraflagellar transport protein 80

OrganismNot specified

UniProt A5Z0S9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A5Z0S9_CHLRE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 1–765； UniProt 1–765 Author chain R； PDBConstruct 1–765； UniProt 1–765

Clusterin-associated protein 1

OrganismNot specified

UniProt A0A2K3CQB1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2K3CQB1_CHLRE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L； PDBConstruct 1–443； UniProt 1–443 Author chain T； PDBConstruct 1–443； UniProt 1–443

Intraflagellar transport protein 57

OrganismNot specified

UniProt Q2XQY7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IFT57_CHLRE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain M； PDBConstruct 1–469； UniProt 1–469 Author chain U； PDBConstruct 1–469； UniProt 1–469

Intraflagellar transport particle protein IFT20

OrganismNot specified

UniProt Q8LLV9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） IFT54 × 2 （A8JBY2） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8LLV9_CHLRE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain W； PDBConstruct 1–135； UniProt 1–135 Author chain Y； PDBConstruct 1–135； UniProt 1–135

IFT54

OrganismNot specified

UniProt A8JBY2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） Intraflagellar transport protein 172 × 2 （Q5DM57）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8JBY2_CHLRE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain X； PDBConstruct 1–510； UniProt 1–510 Author chain Z； PDBConstruct 1–510； UniProt 1–510

Intraflagellar transport protein 172

OrganismNot specified

UniProt Q5DM57

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	IFT88 × 2 （A8JCJ2） Osm-6-like protein × 2 （Q946G4） IFT70 × 2 （A8ITN7） Intraflagellar transport protein 46 × 2 （A2T2X4） Intraflagellar transport protein 56 × 2 （A8JA42） Intraflagellar transport protein 81 × 2 （Q68RJ5） Intraflagellar transport protein 74 × 2 （Q6RCE1） Intraflagellar transport protein 80 × 2 （A5Z0S9） Clusterin-associated protein 1 × 2 （A0A2K3CQB1） Intraflagellar transport protein 57 × 2 （Q2XQY7） Intraflagellar transport particle protein IFT20 × 2 （Q8LLV9） IFT54 × 2 （A8JBY2）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IF172_CHLRE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain S； PDBConstruct 1–1755； UniProt 1–1755 Author chain V； PDBConstruct 1–1755； UniProt 1–1755

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8bd7
Deposition date deposition_date	2022-10-18
Structure title title	IFTB1 subcomplex of anterograde Intraflagellar transport trains (Chlamydomonas reinhardtii)
Keywords keywords	Cilia, IFT, Intraflagellar, transport, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8bd7__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8bd7__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8bd7__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	142.00 Å
Total Rg	141.70 Å
Atom count	86268
Residues	10792
Excluded volume	1533200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8bd7__assembly_1__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	IFT88
Molecular weight formula_weight	86418.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,H
Atom count atom_count	86268

MSYGGTEEDDLYGGYDEQSNPLAGSGGAAFKALGADGAPPGTAMMGPPGTAMKSFVPGTAMRGGTAMQQDPSLARPMTSNRGAGFTSAPNKKFDPLNRSMGSTLGSSGGGAMLVARKGDTSPEEQARGMEKTVHELLEKSAADAAKNDINSALENAMEAKKNERKLCRFREQNNMADQINLELMYAVDFNLAHMYHMNKNYSEALNLYTAIVRNKNFPQSGWLRVNMGNIHFEQKKYPSAIKMYRMALDQISATAKEVRFKIMRNIGLSFVRMGQYPDALQSFATVMDNVPDHQTGYNLVMCNYALSDREGMKNAFIKLLKVSPPSEMDDDDDDDPMGDDDMQVMTMDDGLKDEMRKRNTIITRLIVKAAQLISEKVDRANGFEGGFMWCCEQLRDAGYTKLANEVELAKATRFMGQKQFDKAVGVFKDFEKKEPRVKARAATNLAFLYFLEGETDQADKYSEMALKSDRYNARAYVNKGCVLVERGDLEGARSLFNEAAGIDPYCVEAIYNLGLVSQRLNELPYALAAFKKLHNMVPDNVEVIHQIATTYDMMGDFKNAVKWFELLTSLVSNDPGVLARLGAIHARFDDEAKALHYYQESHRVYPVNMDVISWLGAYHVKSEVYEKAMPFFDLASKIQPQEVKWALMVASCYRRTNNLPAALGKYKQIHTQHPDNVECLRYLVHLCSELGRRAEAAEYMTKLKKAEKAAVPEATTAAAPAAAAAGSGMGGMGGLDDDIGSSAVSAQNRGKKMLVKEHMGGGGGKDNDDWGNEQLGDDLLPM

Entity 2 Entity 2 polymer

Description description	Osm-6-like protein
Molecular weight formula_weight	50453.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,J

MEEPGAEEVRILFSTAKGESHTHKAGFKQLFRRLRSTYRPDKVDKDDFTLDTLRSAHILVLGGPKEKFTAPEVDMLKKFVKNGGSILILMSEGGEEKAGTNINYFLEQFGMSVNNDAVVRTTHYKYLHPKEVLISDGILNRAVITGAGKSLNSNDDDEFRVSRGPQAFDGTGLEYVFPFGATLSVQKPAVPVLSSGKIAYPMNRPVGAVWAQPGYGRIAVLGSCAMFDDKWLDKEENSKIMDFFFKFLKPHSKIQLNDIDAEEPDVSDLKLLPDTASLADKLKGCLQEIDDVPRDWTSLFDDSLFKFDTGLIPEAVSLYEKLGVKKGQLNLIPPSFETPLPPLQPAVFPPTIREPPPPALELFDLDESFASETNRLASLTNKCHGEEDLEYYIMEAGHILGLKLQENANAKHVLSEVFRRIAQYKMGSLGLGQTLDSMGQTLPAANQFGDQFEL

Entity 3 Entity 3 polymer

Description description	IFT70
Molecular weight formula_weight	74248.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,K

MAFFQQPARPIAEGQYTQTIYTLIKEQKFAEAIQHLQYQLQNVPESRAALSLLGYCYYYTGQYDMASQMYEQLVTLYPSNEDYKLYYAQSLYKGGMYPEASKAVVKVEGHQKAVTTLLVACSYEQDDLTGCRRQLDKCAPEDPDTMVNTGCIMFKEGKFEAARQKFNDAVQALGYQPELLYNIALCYYKTKQFGPALKHLAEIIEKAVREHPELSVGSNTDGMEVRSVGNSQTLKETALIEAFNLKAAIEYTMKNVEAAKEALTDMPPRAEEELDPVTLHNSALINMDSDPTGGFKKLNFLLQSPPFPPETFANLLLLYCKPSHGFYDLAADVLAENPQYAGKLLSPDLYDYLQAAIGRYKSPEEAFRRFDELATRHVEQLRRLTKQIQDARIARDNDAIKRAINEYDEALEAYIPGLMAMASIYWDMELYSNVEKIFRQSAEFCSEHEVWKLNVAHTFFMQDNHYKEAIRYYEPVVKKNADNLLGVTAIVLANLCVSYIMTSQNEEAEELMRKVEKEEERSSMQDPDKPCFHLCIINLVIGTLYCAKGNYEFGVSRIIKSLEPYDKKLETDTWYYAKRCFLALIENLAKHMIVLKDSSFTEIMAFLNEAEKHGKDIRVVFNEGKHQSRTIASEARMLKKMFLKLRD

Entity 4 Entity 4 polymer

Description description	Intraflagellar transport protein 46
Molecular weight formula_weight	37976.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,N

MDDSMDYPDRDGDDLDQFQGTARSQVVQNQPHDEEVNLSESESFAGADEPPAAPRDASLIESHDMDEGPAAPARTLSPTGYEAGKHAPGGIANSDEAPPGAYNAQEYKHLNVGEDVRELFSYIGRYKPQTVELDTRIKPFIPDYIPAVGGIDEFIKVPRPDTKPDYLGLKVLDEPAAKQSDPTVLTLQLRQLSKEAPGAKADMVGRLEHTDENKAKKIQQWIASINDIHKAKPAATVNYSKRMPEIEALMQEWPPEVETFLKTMHMPSGDVELDIKTYARLVCTLLDIPVYDDPVESLHVLFTLYLEFKNNPIFRQHMEMENKLDGMSGGGGGMMGGGADVLGL

Entity 5 Entity 5 polymer

Description description	Intraflagellar transport protein 56
Molecular weight formula_weight	63485.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,O

MFYSKSRPQHAARTNVAQAAANEKPKVPELEEFLTKRDYLGAIALLSFRRHANRNDLKNLEWLAYCYFHYGEHDKALVIYKELLQHEDPDPMFFVYSAACLYYMGMYKEAEEQALQGPKCALQTRILFHSAQRQGNDDKLMAYHGQLTDSIEDQLTLASIHYQRSHFQEATDIYKRLLLEHRDYLRSTVVYVALCYCKLDYYDVSLEILGVYLSAFPDSAIAVNLKACNHFRMYNGKAAEAELKTLAELSGGQHLDHDLIRHNLVVFRGGENALQVLPPLSDIPPEARLNLVIHHLRHHEVGEAFGLIKDMEPSTPPEFILKAVVHAMLGQVKGDPEHLKKAQQYYQLVGASASECDTIPGRQCMASCFFLLKQFEDVLVFLSSIKTYFLNDDDFNWNLGIAKAATGKYKEAEETLLQIANDKYRNEYTYTSWLARCYIMNGKARLAWERYLQLETNDESYQLLLLIANDCYKMGAFYFACKAFDVLERLDPAPEYLEGKKGAACGAFQMIVAGKEPKDLLRDVISLLRGNNSADQCEPIVAVMRKWAKNNGVKL

Entity 6 Entity 6 polymer

Description description	Intraflagellar transport protein 81
Molecular weight formula_weight	77186.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,P

MGDVSYIVDSLGLPPFSYQMSLLSFTEKGPQELLQLLSDVFSTISPKHQKVDVAKEVPDQTADRLIGFLKIIKYRPNVQDPLLFRQLVAAGDRETLYQILRWVVPQAQLLEKRAFVGYYLSFPDMPEEFNFDPDIMELKEEIKAMQQEFIELHKSSDAIKTLSKDTQALKNKIKSLEEEKERLGEKVERAKGAVDKLPDRSSYMEVCTNLRKQQDEEVNLSTAIQTQRALQEKAEASYHRAAARLRELQTSYQEGSAGKLLETLNEDVKNLRAQVNERYPKEVEKRQKRQAALSEALASGISTEMDLQRLQHQATALHNQITEIQERKVAQDKARQGDKAYLQLRQAQQMATVSARKKEELGAKQERLQEKKTALTAQLDKLNAEGGGSGAVFSEEEWRTKYESMKSKLPIYKKMKKELGDLEAEVFVLAHTEELLASQEGGLLEKVKRLEKQQGISGFTETAQHLEKVSEAKSQMDEEKGMTLIEISRTVEEINNAINQRKQQLAPQIKKLRSVRQDFAEFEAKYLEKKTAYDNVVATFEARTSALEGEVSGLKAEVSENETKYHMLHCQLHITDQNIKKVTSGPAAERLRDKYEAKVKEAEDSTKALRDRQREIKDTHSTGLSQIDIMNDMLRLLQLKLNLARGIAVDMSQYGGGGGAAGGANGGMAGQTYDTGSANVLQL

Entity 7 Entity 7 polymer

Description description	Intraflagellar transport protein 74
Molecular weight formula_weight	71648.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,Q

MDRPSSRGALALGAGGLGKAPTGGAVQQPDRPMTGQRGAAPAGPMRAPAGASIIGAGPPGTAMRGGPGPAGGPPGTAYKRMGTASQRPGTGQQAAAAAAAARAGQQLQVENRPITNHGVSGMKTAAAGVGRQVLDKNYFMNELRQKRMEIAQVTSNMKSDLEALERKQAQYNSMDKRASDLSKEVKILQEALADYNTVLDKVGSQAPVYVIQQEFAALKDRNEQQRKRVDEVLTERLNLESKAKQAESKMSEIQASMDQRLNSMPPSQRNEYTTLVAEQQQLQADSKRFEEVLDELDKALQASEGELARNPFKQRSLQLQEQIRALTEKKYELTEEERQSKRSPEELRADLMAKIKRDNTEVEQMTQQIRELQDQIKKMEERVKSLGGATSGAAAAEEKANREKFEELLAKERDLNNFMDGFPSRKAAKMQEKQQKEDGIVGVLEKMVKMQGIIGSNLPSQKKYKEMQDELEYKKMQLENTQTTQERLKEELTMRRTELEKIDTLEDKIKLELTQLAERQEAMEKEMGEFGSVEDIQRKANAARERMEGLRSVLLKRKDLLRSIVAERGLKFQAKRAQLQDHNLQVQLEKMEAKLKNLSAGVFEMDEFIKAKESETNYRQLASNIAALVDDLNVHVKKAVV

Entity 8 Entity 8 polymer

Description description	Intraflagellar transport protein 80
Molecular weight formula_weight	85782.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,R

MRLKVKQSSANVHSELTAAVGWNVWNELFTCSDDQTIHKWNMLGEPEQKVSTLDAYFTDMHWYPVSSKKTQAGGTDVFAVACTDGSVKILSRTGRVEKSIEGHKGACISLRWSYDGTALATAGEDGSVKIWSRNGMLRSTLAQADSPVYSIVWAYDCDQLCYCTGSNVVIKSLSSNAKQNAWKAHDGVVLKVDWSPINHLIITGGEDCKYKVWDSFGRLLFQSGLFDYPVTSVAWAPSGELFAVGGFNTLQLCDRMGWAYSKIHLNDTGSIMTLSWTADSTQLAGGGGSGGVVFGQVVDLALEDGKMQVTVVDDMRIVVNDILNENADELPEFRDRVIKVSLGYGYLIVATATQCHVYNTTNLGTPHIFDLKDTVTLLLQAERHFLLLDNSAGIQIYTYEGRQICNPRFQGLRTELLNAQMITLSNDTIAVLDQQASGTTVRFFDTAQGRPVGEPWQHTLEVKEIALSQAGTINDRQLIVIDRNRDLYLLPVMKRHVAKLAAMCDSARWHDSTAMLSAMVDQRLCVWYYPSEVYVDKDLLAKTRYTKSDSDFGKSAQIQLFAGNRCLVRRSDGVLVSAATSPYPAVLYDMIRKQQWDKATRLCRFIKDPTMWATLAAMAMAAKELNTAEVAFAAIDEVDKTHFVRKVKQIPTEEGRNAELAVYRRKPEEGESILLQAGLVFRAIKLNIKLFNWERALDLATQHKQHQDTVLWYRQQFLKNAKLAESITRFMQMNESVVVDQAAVKKKIEEERIKESQRPGAKRYV

Entity 9 Entity 9 polymer

Description description	Clusterin-associated protein 1
Molecular weight formula_weight	49733.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,T

MSFRELRSFTEVMKALGYPRLISMENFRVPNFELVADCLYWLVHRYYPGVEIADDISTESDRVKFLQSVAQVMLTKARMKLNIKRLYAADGNAVKELLKLASLLYKATSKAGDMDDDAAEAIDVANSLKGFNPKEIKGLAAEIIKAGAGLYDALGQEPELREHRARAVAGHVDTDFVERSIREAIAQVEDNIRSLENQMEDLERNEKTLDNKIEKKKQELERQEKRLSTLQSVRPAYMDEYERLQGELNGLYQSYLDRFRNLEFLENELEAYYQAEQEKMEAQERRLKKMQKRLKEEELRILRGEQEVDEANMNFDDDDMDLSEDGEHEEAEEGEDEDYGAGGQKATMRRDQFGGQGGGGGGGRQQGGGRNVMGNLDGDFDDEASIDEDDNTDGGEVSRQGSQAGGMGGGGGYGGGGGYMNGGGMDDDENNLIQDDDEDDNDF

Entity 10 Entity 10 polymer

Description description	Intraflagellar transport protein 57
Molecular weight formula_weight	51298.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,U

MSSKRGGRSSLAKAPEEAVNGEAFAPEASPPPPGDDGDAGGEDGGAPAPPPPPATKGGPVAVGRSLEIQTTPDVCMEMLADKLKLLNYEADFCRKKKPYRKPLSRLYFAVPLANSSEQFFYFTSLATWLLGLAGVELPAPKEFDDPNLTCQNILGAVKKLGFAPPSYHPTKLTVGNGKEVVGVLDGLVDFVLERRHHKYSRPAYGNDGQPEEGVQLDDEAEAAAMEGADELAMPAQNQADDDEEEEGVYVDPGRGDAAGPGTGASAAMDAEKAVLVSKVDPTLWKIELERVAPKLRITIAADSKDWRSHLDEAHQHKEVISKAWPDSKTSLERLRADLNGTLEKLQTREKFLNEQAESLMQQYRAARTTFTDVQETYNRKTEAVADRNQEMHRIGETLEEVKAMMDEKGSNIADATPVARIKTAIKQLNKELHDMEVRIGVVSHTLLQLSLRNKRLLQAQAALSDEEED

Entity 11 Entity 11 polymer

Description description	Intraflagellar transport particle protein IFT20
Molecular weight formula_weight	15658.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,Y

MDAVDRGVYFDEDFHVRILDVDKYNASKSLQDNTNVFINNIQNMQGLVDKYVSAIDQQVERLEAEKLKAIGLRNRVAALSEERKRKQKEQERMLAEKQEELERLQMEEQSLIKVKGEQELMIQKLSDSSSGAAYV

Entity 12 Entity 12 polymer

Description description	IFT54
Molecular weight formula_weight	54437.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X,Z

MCDNWQATIDTLQGASPVFDKPKLSQKLLEKPPFRFLHDVVTAVQQATGFAPGLYQGDELDGKAIQEKDAKVAYLKKIIEVVSMVLGEQCPARPNKIVAGLEPENTNIFLQMLGRACQKGNGAKAVQKVLGGGGAEPAPAKEEAPPPEKKPEKKEKKEEKPAEKSRAEASPARKKAAEPEAEKKSSSKSSSRTKEEPPAKAPAKKKEEPAPEKPSKSKAAPAAEEAPPPPPPPAAEPPARSASPGGEDPLNKSGSAAPKFQRPTSARKAPPRVPQPQQPTMLAGTGIRPGTATRRPNEPKPTDSKVTKPVAVFTDNAKDNSDDEVEVVHEQTPVLSGGANMTGEQGVLVKDILAAEKGLKKAGVDATADNADTSDQGSTGIILKRLGGKAAGAGAAAAGPRAHDPSSVRELVQKLCHSSTPLAKSMDYLQEDIENMRKEYKFWLTEKRMYQDELARELRLQGEAANVDAQLADLDGQIKQARDRIIGMKGQILRNDETLGKLLAMATAGR

Entity 13 Entity 13 polymer

Description description	Intraflagellar transport protein 172
Molecular weight formula_weight	197851.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,V

MQLRYFKSILPPADQYQKITSLTWAPNNSRLAAVSTDKVVYLFDENGEKRDKFKTKAAEANNPNTYIIRAMAFSPDSTKLAIAQSDNIVFIYRLVDPDTGAEKKSICNKFPQACAVTSLVWPKDRPNEVVFGLADGKVRLGMLKNNKSYTCYAHPENSYVVALASSLNGQNVISGHMDGAIWKFNFPAEEGGTPTSSQLVVHSCVPYSLGWGSCIAAAGNDNRVVFYDLNGREIRSFDYSNNDEVREFTTCAFNPSGDTVVFGTYNRFYMYTFNIQRNDWEEAGHKQIDNFYAVSAASWKPDGSKMTVGSMTGAVDMYDACVKRHMYKGKFEFTYVSKSAVIVKTLKTGMRIVLKSVYGYEIEKINIYHDRYLIARTTYTLLMGDLDTCKLSEIPWDSDGSEKFHFENERVCMVHYAGELHIVEYGRNDVLGTCRTEHMNPYLISAVVQEARGIASESKKLAYLIDLQTVRIQDLMAPVGSTLATVNHDTKVDWLELNQRGTHLLFRDKKRHLHLFSLSGQERTTLLNYCQYVQWVPGSDVIVAQSRNNLCVWYSVNKPDNVTMFPIKGEVVDIERHNHRTEVIVDEGINTVSYALDEALIYFGAALEDQDYERAVQTLEPLELTPETEAQWMQLAEQALATNQLVIAERCYAALGDIAKSRFLHKVVKKAQQAAKEFGGDGTDAWSVRAMMAQLNKQWPVSESLLLAQGKVDDAITLYQDNHRWEDAIRVADSTHHANAAALKQQYLTWLLETGQEEQAGAVKEREGDYLAAIGLYLKGGLPGRAAQVVMSVHNVNWDPALLDSILASLAKAGLYERAGELYEHMSRSSEAMQSYRRGHAYRKAIDLARREFPAEVIIIEEEWGDWLVTQKQMDAAINHFIESGATLKAIKAAIDCRQFAKAAGIIEVLDPREAMPYFRRIAQHYETTGALEEAERYYIRADMARDAVEMYSRAGKWEAAQRVARGYLTESEMRAFYRAKAAEFEAAHKLKEAEKAYLAAGGDDVDKAIAMYKRNKMYDQMIRLVTQYRKEKVPEAHTLIAQQLEVEGNLREAEKHFVEAKDWKSAVQMYRQVNQWEDALRVAKVYGGVNASKQVAYAWALTLGGDDGAQLLKKMGLLDHAIEYAVESGAFAQAFEMTRAGAKHKLPEVHLKYAMFLEDEGRFAEAEAEFISAGKPKEACDMYMHNQDWDAAMRIAERYDPTMVSEILVSQARVAVERKQWLPAEGLFIKAKRPEAALKMYRDARMWNDALRVAEQYLPTKVAEVQMELLSGQGAGGGSGGASADAVINKARGFERNNDYARAIETYLSLTAQDTSNQDQLEHCWGQAAQLAINYQRHRMKDVVNTVSERLQEIGRHQAAGELHESIDDAQGAIRAYCAGRLWDKARTLAGTNPTFSRYIEDQYNNYLLQNQQADELASRGGQHAQQAIEMYVARDEWAKVHELAAQQGPEVASNYALKHAERRFKQGDYAQAAQVFAQHGITAQPQYFELYKSIAQGVLHASQGDRNPVAEKSLRDMMYRLVNVLRSGGGAGKYKVDTDAFQNYYLAAHYLTCAAAAKEQGLKDIAAMNLTSVLRYVGPTIPADRAFYEAGLAWYEAGRKNMAFVMLNRFLDLSDAMDEPDSSAAVIENADFSDTDIPYDFTIPERAYCTESQREDVRNLVLEISMDRSSDQSLALKACEHCGKPTYEANLTCHFCKKKYDPCVVTGYPIQSYDRVVFKNNGPELNAIRDMWNKWVEAFGTDPVTGMQAAPMY

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	9.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	18216

IFTB1 subcomplex of anterograde Intraflagellar transport trains (Chlamydomonas reinhardtii)

1. Protein Identity and Related Structures Protein Identity & Related Structures

IFT88

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Osm-6-like protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

IFT70

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intraflagellar transport protein 46

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intraflagellar transport protein 56

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intraflagellar transport protein 81

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intraflagellar transport protein 74

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intraflagellar transport protein 80

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Clusterin-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Intraflagellar transport protein 57

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer