SAXSdb — 8cn1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disks large homolog 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 24	GLU-THR-GLU-VAL × 12 SULFATE ION × 9 water × 23	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DLG1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 17–109； UniProt 219–311 Author chain B； PDBConstruct 17–109； UniProt 219–311 Author chain C； PDBConstruct 17–109； UniProt 219–311 Author chain D； PDBConstruct 17–109； UniProt 219–311 Author chain E； PDBConstruct 17–109； UniProt 219–311 Author chain F； PDBConstruct 17–109； UniProt 219–311 Author chain G； PDBConstruct 17–109； UniProt 219–311 Author chain H； PDBConstruct 17–109； UniProt 219–311 Author chain I； PDBConstruct 17–109； UniProt 219–311 Author chain J； PDBConstruct 17–109； UniProt 219–311 Author chain K； PDBConstruct 17–109； UniProt 219–311 Author chain L； PDBConstruct 17–109； UniProt 219–311

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8cn1
Deposition date deposition_date	2023-02-21
Structure title title	hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1
Keywords keywords	HTLV-1; Tax-1; hDLG1; PBM, protein protein interaction, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8cn1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8cn1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8cn1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.94 Å
Rg (electron density)	36.25 Å
Total Rg	36.68 Å
Atom count	9027
Residues	1190
Excluded volume	158220 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8cn1__assembly_1__model_1`	24-meric （24）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Disks large homolog 1
Molecular weight formula_weight	12524.0 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	9661

GPLGSETPTYVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKIM

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	GLU-THR-GLU-VAL
Molecular weight formula_weight	476.5 kDa
Source method src_method	syn
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V,W,X,Y,N,O,P,Q,R,T,Z,U

ETEV

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	9

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	628

▼

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

Domain ID domain_id	8cn1G01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	8cn1H01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	8cn1I01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	8cn1J01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	8cn1K01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	8cn1L01
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

▶

Unit-cell length a length_a	53.537 Å
Unit-cell length b length_b	82.905 Å
Unit-cell length c length_c	87.784 Å
Unit-cell angle α angle_alpha	64.10 °
Unit-cell angle β angle_beta	90.14 °
Unit-cell angle γ angle_gamma	89.87 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.090 Å
Low-resolution limit resolution_low	45.250 Å
R factor r_factor	0.2016
R_work r_work	0.1991
R_free r_free	0.2462

hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disks large homolog 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8cn1__assembly_1__model_1

8cn1__assembly_1__model_1 | I(q)

8cn1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)

hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disks large homolog 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8cn1__assembly_1__model_1

8cn1__assembly_1__model_1 | I(q)

8cn1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

CATH v4.4 (6 domains)

7. Citations (1)