3rl7

Crystal structure of hDLG1-PDZ1 complexed with APC

Method: X-RAY DIFFRACTION D_max: 84.7 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disks large homolog 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 220–317	Fragment：UNP RESIDUES 220-317	11-mer peptide from Adenomatous polyposis coli protein × 1 （P25054）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 220–317	Fragment：UNP RESIDUES 220-317	11-mer peptide from Adenomatous polyposis coli protein × 1 （P25054）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 220–317	Fragment：UNP RESIDUES 220-317	11-mer peptide from Adenomatous polyposis coli protein × 1 （P25054）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 220–317	Fragment：UNP RESIDUES 220-317	11-mer peptide from Adenomatous polyposis coli protein × 1 （P25054）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 220–317	Fragment：UNP RESIDUES 220-317	11-mer peptide from Adenomatous polyposis coli protein × 1 （P25054）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain F； UniProt 220–317	Fragment：UNP RESIDUES 220-317	11-mer peptide from Adenomatous polyposis coli protein × 1 （P25054）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 3RL7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1PDR CRYSTAL STRUCTURE OF THE THIRD PDZ DOMAIN FROM THE HUMAN HOMOLOG OF DISCS LARGE PROTEIN Deposited 1996-07-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 457–555（99 aa） Fragment：PDZ3 DOMAIN, DHR3 DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.271
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51 oncoprotein E6 residues 141-151 Deposited 2013-01-22	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 318–406（89 aa） Fragment：hDlgPDZ2, UNP residues 318-406	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 20；Pressure ambient NMR sample composition 0.8 mM [U-100% 13C; U-100% 15N] hDlgPDZ2, 2.0 mM E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.8 mM [U-100% 13C; U-100% 15N] hDlgPDZ2, 2.0 mM E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 100% D2O \| 100% D2O NMR sample composition 3.12 mM hDlgPDZ2, 1.25 mM [U-100% 13C; U-100% 15N] E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 100% D2O \| 100% D2O NMR sample composition 3.12 mM hDlgPDZ2, 1.25 mM [U-100% 13C; U-100% 15N] E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide Deposited 2007-02-01	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 318–405（88 aa） Fragment：second PDZ domain, residues 318-406	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR sample composition 2mM hDLG/SAP97 PDZ2 domain, 3mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 99.5% D2O \| 99.5% D2O NMR sample composition 2mM hDLG/SAP97 PDZ2 domain U-15N, 3mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain U-15N, 13C, 3 mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20 mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain, U-15N, U-10%13C, 3 mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5 \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain, U-15N, 3 mM HPV-18 E6 peptide, 5% C8E5, C8E5/n-octanol 0.87, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain, U-15N, 3 mM HPV-18 E6 peptide, 10 mg/ml pf1 phage, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5,90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2X7Z Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain Deposited 2010-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 260–356（97 aa） Fragment：PDZ2 DOMAIN, RESIDUES 260-356	Mutation：YES	NH4 AMMONIUM ION × 2 IMD IMIDAZOLE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.4；VAPOR DIFFUSION, 100MM TRIS-HCL PH 8.4, 2.4M AMMONIUM SULPHATE	Resolution 2.00 Å R-free 0.232
3LRA Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3 Deposited 2010-02-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–65（64 aa） Fragment：L27 domain, L27 1/2 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；10% PEG 8000, 0.2M MgCl2, 0.1M Guanidine HCl, 0.1M Tris-HCl, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.95 Å R-free 0.284
3RL8 Crystal structure of hDLG1-PDZ2 complexed with APC Deposited 2011-04-19	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain B 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain C 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain D 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain E 315–410（96 aa） Fragment：UNP RESIDUES 315-410	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.20 Å R-free 0.245
4AMH Influence of circular permutation on the folding pathway of a PDZ domain Deposited 2012-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 327–405（79 aa） Fragment：PDZ2 DOMAIN Chain A 315–326（12 aa） Fragment：PDZ2 DOMAIN Chain B 327–405（79 aa） Fragment：PDZ2 DOMAIN Chain B 315–326（12 aa） Fragment：PDZ2 DOMAIN	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；SITTING DROP VAPOR DIFFUSION, 0.1 M MES PH 6.0, 2.4 M AMMONIUM SULFATE	Resolution 2.30 Å R-free 0.268
4G69 Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Deposited 2012-07-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 310–407（98 aa） Fragment：PDZ2, UNP residues 310-407	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；300 K；Protein solution: 1.4 mM Dlg1 PDZ2, 1.7 mM APC, 100 mM NaCl, 25 mM Tris pH 7.0, 0.1% B-ME Well: 200 mM sodium acetate, 100 mM sodium cacodylate pH 6.25, 28% PEG 8000 Drop = 1:1 protein:well solution , VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.00 Å R-free 0.183
7PC3 The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1 Deposited 2021-08-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 314–413（100 aa）	Not recorded	CA CALCIUM ION × 4 GOL GLYCEROL × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Lithium sulfate, 0.1 M bis-Tris pH 5.5, 25% w/v PEG 3350	Resolution 1.95 Å R-free 0.201
8CN1 hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1 Deposited 2023-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 219–311（93 aa） Chain B 219–311（93 aa） Chain C 219–311（93 aa） Chain D 219–311（93 aa） Chain E 219–311（93 aa） Chain F 219–311（93 aa） Chain G 219–311（93 aa） Chain H 219–311（93 aa） Chain I 219–311（93 aa） Chain J 219–311（93 aa） Chain K 219–311（93 aa） Chain L 219–311（93 aa）	Not recorded	SO4 SULFATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M Bis-Tris pH 5.5, 0.18 M (NH4)2SO4, 24% PEG3350	Resolution 2.09 Å R-free 0.246
8CN3 hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1 Deposited 2023-02-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 260–371（112 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M Bis-Tris pH 5.5, 0.075M (NH4)2SO4, 24% PEG3350	Resolution 2.71 Å R-free 0.259
8CN3 hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1 Deposited 2023-02-21	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 195–306（112 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M Bis-Tris pH 5.5, 0.075M (NH4)2SO4, 24% PEG3350	Resolution 2.71 Å R-free 0.259

11 other PDB entries and 12 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DLG1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 10–107； UniProt 220–317 Author chain B； PDBConstruct 10–107； UniProt 220–317 Author chain C； PDBConstruct 10–107； UniProt 220–317 Author chain D； PDBConstruct 10–107； UniProt 220–317 Author chain E； PDBConstruct 10–107； UniProt 220–317 Author chain F； PDBConstruct 10–107； UniProt 220–317

11-mer peptide from Adenomatous polyposis coli protein

OrganismNot specified

UniProt P25054

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain G； UniProt 2833–2843	Not recorded	Disks large homolog 1 × 1 （Q12959）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain H； UniProt 2833–2843	Not recorded	Disks large homolog 1 × 1 （Q12959）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain J； UniProt 2833–2843	Not recorded	Disks large homolog 1 × 1 （Q12959）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
4	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain I； UniProt 2833–2843	Not recorded	Disks large homolog 1 × 1 （Q12959）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
5	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain K； UniProt 2833–2843	Not recorded	Disks large homolog 1 × 1 （Q12959）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
6	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain L； UniProt 2833–2843	Not recorded	Disks large homolog 1 × 1 （Q12959）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 3RL7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1DEB CRYSTAL STRUCTURE OF THE N-TERMINAL COILED COIL DOMAIN FROM APC Deposited 1999-11-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–55（54 aa） Fragment：N-TERMINAL COILED COIL DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；277 K；15% PEG 4000, 0.1M AMMONIUM ACETATE, 0.1M NA ACETATE, pH 4.8, VAPOR DIFFUSION, HANGING DROP	Resolution 2.40 Å R-free 0.277
1DEB CRYSTAL STRUCTURE OF THE N-TERMINAL COILED COIL DOMAIN FROM APC Deposited 1999-11-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–55（54 aa） Fragment：N-TERMINAL COILED COIL DOMAIN	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；277 K；15% PEG 4000, 0.1M AMMONIUM ACETATE, 0.1M NA ACETATE, pH 4.8, VAPOR DIFFUSION, HANGING DROP	Resolution 2.40 Å R-free 0.277
1DEB CRYSTAL STRUCTURE OF THE N-TERMINAL COILED COIL DOMAIN FROM APC Deposited 1999-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 2–55（54 aa） Fragment：N-TERMINAL COILED COIL DOMAIN Chain B 2–55（54 aa） Fragment：N-TERMINAL COILED COIL DOMAIN	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；277 K；15% PEG 4000, 0.1M AMMONIUM ACETATE, 0.1M NA ACETATE, pH 4.8, VAPOR DIFFUSION, HANGING DROP	Resolution 2.40 Å R-free 0.277
1DEB CRYSTAL STRUCTURE OF THE N-TERMINAL COILED COIL DOMAIN FROM APC Deposited 1999-11-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–55（54 aa） Fragment：N-TERMINAL COILED COIL DOMAIN Chain B 2–55（54 aa） Fragment：N-TERMINAL COILED COIL DOMAIN	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；277 K；15% PEG 4000, 0.1M AMMONIUM ACETATE, 0.1M NA ACETATE, pH 4.8, VAPOR DIFFUSION, HANGING DROP	Resolution 2.40 Å R-free 0.277
1DEB CRYSTAL STRUCTURE OF THE N-TERMINAL COILED COIL DOMAIN FROM APC Deposited 1999-11-14	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–55（54 aa） Fragment：N-TERMINAL COILED COIL DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.8；277 K；15% PEG 4000, 0.1M AMMONIUM ACETATE, 0.1M NA ACETATE, pH 4.8, VAPOR DIFFUSION, HANGING DROP	Resolution 2.40 Å R-free 0.277
1EMU STRUCTURE OF THE AXIN RGS-HOMOLOGOUS DOMAIN IN COMPLEX WITH A SAMP REPEAT FROM APC Deposited 2000-03-17	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2034–2049（16 aa） Fragment：THIRD SAMP REPEAT	Not recorded	GOL GLYCEROL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；MES, PEG 400, glycerol, DTT, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 1.90 Å R-free 0.221
1JPP The Structure of a beta-Catenin Binding Repeat from Adenomatous Polyposis Coli (APC) in Complex with beta-Catenin Deposited 2001-08-02	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1021–1035（15 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；293 K；PEG 8000, sodium potassium phosphate, sodium chloride, DTT, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.10 Å R-free 0.274
1JPP The Structure of a beta-Catenin Binding Repeat from Adenomatous Polyposis Coli (APC) in Complex with beta-Catenin Deposited 2001-08-02	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1021–1035（15 aa）	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；293 K；PEG 8000, sodium potassium phosphate, sodium chloride, DTT, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 3.10 Å R-free 0.274
1M5I Crystal Structure of the coiled coil region 129-250 of the tumor suppressor gene product APC Deposited 2002-07-09	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–250（125 aa） Fragment：coiled-coil region	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；16% PEG 3350, 100mM potassium iodide, 10mM strontium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.309
1T08 Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3 Deposited 2004-04-07	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1484–1498（15 aa） Fragment：repeat 3 (RESIDUES 1484-1498)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 6.5；297 K；PEG3400, Potassium phosphate, pH 6.5, EVAPORATION, temperature 297K	Resolution 2.10 Å R-free 0.241
1TH1 Beta-catenin in complex with a phosphorylated APC 20aa repeat fragment Deposited 2004-05-31	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1362–1540（179 aa） Fragment：phosphorylated 20 amino acid repeat	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Tris, sidium chloride, PEG2000MME, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.257
1TH1 Beta-catenin in complex with a phosphorylated APC 20aa repeat fragment Deposited 2004-05-31	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1362–1540（179 aa） Fragment：phosphorylated 20 amino acid repeat	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；Tris, sidium chloride, PEG2000MME, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.50 Å R-free 0.257
1V18 The crystal structure of beta-catenin armadillo repeat complexed with a phosphorylated APC 20mer repeat. Deposited 2004-04-09	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1482–1528（47 aa） Fragment：RESIDUES 1482-1528	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.50	Resolution 2.10 Å R-free 0.253
2RQU Solution structure of the complex between the DDEF1 SH3 domain and the APC SAMP1 motif Deposited 2009-12-14	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1578–1596（19 aa） Fragment：UNP residues 1578-1596	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.2；278 K；Pressure ambient NMR sample composition 0.5 mM [U-15N] DDEF1 SH3-1, 0.5 mM [U-15N] APC SAMP1-2, 5 mM sodium phosphate-3, 5 mM [U-2H] DTT-4, 0.02 % sodium azide-5, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-13C; U-15N] DDEF1 SH3-6, 0.5 mM [U-13C; U-15N] APC SAMP1-7, 5 mM sodium phosphate-8, 5 mM [U-2H] DTT-9, 0.02 % sodium azide-10, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-13C; U-15N] DDEF1 SH3-11, 0.5 mM [U-13C; U-15N] APC SAMP1-12, 5 mM sodium phosphate-13, 5 mM [U-2H] DTT-14, 0.02 % sodium phosphate-15, 100% D2O \| 100% D2O NMR sample composition 0.5 mM [U-15% 13C; U-15N] DDEF1 SH3-16, 0.5 mM [U-15% 13C; U-15N] APC SAMP1-17, 5 mM sodium phosphate-18, 5 mM [U-2H] DTT-19, 0.02 % sodium azide-20, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3AU3 Crystal structure of armadillo repeat domain of APC Deposited 2011-01-28	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 396–732（337 aa） Fragment：Armadillo repeat, UNP residues 396-732	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；293 K；100mM sodium acetate, 1.25M lithium citrate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.10 Å R-free 0.232
3QHE Crystal structure of the complex between the armadillo repeat domain of adenomatous polyposis coli and the tyrosine-rich domain of Sam68 Deposited 2011-01-25	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 396–732（337 aa） Fragment：Armadillo repeat domain, residues 396-732	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；100mM BIS-TRIS (pH 5.5), 150mM NaCl, 20% PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.230
3QHE Crystal structure of the complex between the armadillo repeat domain of adenomatous polyposis coli and the tyrosine-rich domain of Sam68 Deposited 2011-01-25	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 396–732（337 aa） Fragment：Armadillo repeat domain, residues 396-732	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；100mM BIS-TRIS (pH 5.5), 150mM NaCl, 20% PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.40 Å R-free 0.230
3RL8 Crystal structure of hDLG1-PDZ2 complexed with APC Deposited 2011-04-19	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 2833–2843（11 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.20 Å R-free 0.245
3T7U A NeW Crystal structure of APC-ARM Deposited 2011-07-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 407–775（369 aa） Fragment：ARM 1-7 domain, UNP residues 407-775	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；287 K；1.02M Sodium phosphate monobasic monohydrate, 0.18M Potassium phosphate dibasic, vapor diffusion, hanging drop, temperature 287K	Resolution 2.90 Å R-free 0.313
3T7U A NeW Crystal structure of APC-ARM Deposited 2011-07-31	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 407–775（369 aa） Fragment：ARM 1-7 domain, UNP residues 407-775	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；287 K；1.02M Sodium phosphate monobasic monohydrate, 0.18M Potassium phosphate dibasic, vapor diffusion, hanging drop, temperature 287K	Resolution 2.90 Å R-free 0.313
4G69 Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Deposited 2012-07-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2833–2843（11 aa） Fragment：APC C-terminal peptide, UNP residues 2833-2843	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；300 K；Protein solution: 1.4 mM Dlg1 PDZ2, 1.7 mM APC, 100 mM NaCl, 25 mM Tris pH 7.0, 0.1% B-ME Well: 200 mM sodium acetate, 100 mM sodium cacodylate pH 6.25, 28% PEG 8000 Drop = 1:1 protein:well solution , VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.00 Å R-free 0.183
4YJE Crystal structure of APC-ARM in complexed with Amer1-A1 Deposited 2015-03-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；287 K；12% PEG 20000	Resolution 1.90 Å R-free 0.221
4YJL Crystal structure of APC-ARM in complexed with Amer1-A2 Deposited 2015-03-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	EDO 1,2-ETHANEDIOL × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；287 K；0.2M NACL, 10% PEG 8000	Resolution 2.10 Å R-free 0.225
4YJL Crystal structure of APC-ARM in complexed with Amer1-A2 Deposited 2015-03-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；287 K；0.2M NACL, 10% PEG 8000	Resolution 2.10 Å R-free 0.225
4YJL Crystal structure of APC-ARM in complexed with Amer1-A2 Deposited 2015-03-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	EDO 1,2-ETHANEDIOL × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；287 K；0.2M NACL, 10% PEG 8000	Resolution 2.10 Å R-free 0.225
4YJL Crystal structure of APC-ARM in complexed with Amer1-A2 Deposited 2015-03-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；287 K；0.2M NACL, 10% PEG 8000	Resolution 2.10 Å R-free 0.225
4YJL Crystal structure of APC-ARM in complexed with Amer1-A2 Deposited 2015-03-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	EDO 1,2-ETHANEDIOL × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；287 K；0.2M NACL, 10% PEG 8000	Resolution 2.10 Å R-free 0.225
4YJL Crystal structure of APC-ARM in complexed with Amer1-A2 Deposited 2015-03-03	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；287 K；0.2M NACL, 10% PEG 8000	Resolution 2.10 Å R-free 0.225
4YK6 Crystal structure of APC-ARM in complexed with Amer1-A4 Deposited 2015-03-04	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：ARM DOMAIN, UNP RESIDUES 407-751	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；287 K；0.2M NACL, 10% PEG8000	Resolution 1.70 Å R-free 0.240
5B6G Protein-protein interaction Deposited 2016-05-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：UNP RESIDUES 407-751	Not recorded	SO4 SULFATE ION × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；0.2 M Ammonium sulfate, 0.1 M Tris pH 8.0, 25 % w/v PEG 4000	Resolution 1.99 Å R-free 0.215
5IZ6 Protein-protein interaction Deposited 2016-03-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：UNP RESIDUES 407-751	Not recorded	SO4 SULFATE ION × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；0.2M Ammonium sulfate 0.1M Tris pH 8.0, 25% w/v PEG 3350	Resolution 2.15 Å R-free 0.206
5IZ8 Protein-protein interaction Deposited 2016-03-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：UNP RESIDUES 407-751	Not recorded	PGE TRIETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；0.2M Ammonium sulfate, 0.1M Tris pH 8.0, 25% w/v PEG 4000	Resolution 3.06 Å R-free 0.253
5IZ8 Protein-protein interaction Deposited 2016-03-25	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 407–751（345 aa） Fragment：UNP RESIDUES 407-751	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；0.2M Ammonium sulfate, 0.1M Tris pH 8.0, 25% w/v PEG 4000	Resolution 3.06 Å R-free 0.253
5IZ9 Protein-protein interaction Deposited 2016-03-25	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：UNP RESIDUES 407-751	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；0.2M Ammonium sulfate, 0.1M Tris pH 8.0, 25 % w/v PEG 4000	Resolution 2.93 Å R-free 0.282
5IZA Protein-protein interaction Deposited 2016-03-25	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa） Fragment：UNP RESIDUES 407-751	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；291 K；0.2M Ammonium sulfate, 0.1M Tris pH 8.0, 25% w/v PEG 4000	Resolution 1.50 Å R-free 0.159
5Z8H APC with an inhibitor Deposited 2018-01-31	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–741（335 aa）	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Ammonium sulfate 0.1M Tris pH 8.0, 25% w/v PEG 3350	Resolution 1.79 Å R-free 0.211
7F6M Crystal structure of APC complexed with a peptide inhibitor MAI-516 Deposited 2021-06-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–751（345 aa）	Not recorded	GOL GLYCEROL × 5 SO4 SULFATE ION × 2 PEG DI(HYDROXYETHYL)ETHER × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Ammonium sulfate 0.1M Tris pH 8.0, 25% w/v PEG 3350	Resolution 2.40 Å R-free 0.256
7F7O APC-Asef FP assay tracer Deposited 2021-06-30	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 407–738（332 aa）	Not recorded	4CI N-[3',6'-bis(oxidanyl)-3-oxidanylidene-spiro[2-benzofuran-1,9'-xanthene]-5-yl]methanethioamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Ammonium sulfate, 0.1M Tris pH 8.0, 25% w/v PEG 3350	Resolution 2.80 Å R-free 0.328
7XTY Crystal Structure of the second PDZ domain from human PTPN13 in complex with APC peptide Deposited 2022-05-18	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2833–2843（11 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.8；289 K；0.1M citric acid (pH 3.5), 3M NaCl	Resolution 2.10 Å R-free 0.240
7XTY Crystal Structure of the second PDZ domain from human PTPN13 in complex with APC peptide Deposited 2022-05-18	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2833–2843（11 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.8；289 K；0.1M citric acid (pH 3.5), 3M NaCl	Resolution 2.10 Å R-free 0.240
8GSJ APC-Asef tripeptide inhibitor Deposited 2022-09-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 407–738（332 aa）	Not recorded	K8C 2-methylsulfanylpyrimidine-4-carbaldehyde × 1 GLU GLUTAMIC ACID × 1 NAL BETA-(2-NAPHTHYL)-ALANINE × 1 LEU LEUCINE × 1 GJZ (1R,2S)-2-phenylcyclopropanamine × 1 GOL GLYCEROL × 4 SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；0.2M Ammonium sulfate, 0.1M Tris pH 8.0, 25% w/v PEG 4000	Resolution 2.10 Å R-free 0.256
8X2Q The Crystal Structure of APC from Biortus. Deposited 2023-11-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 126–250（125 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；(PEG-G2) 0.2M NaAc pH 7.0, 20% PEG 3350	Resolution 2.00 Å R-free 0.263

27 other PDB entries and 42 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	APC_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain G； PDBConstruct 1–11； UniProt 2833–2843 Author chain H； PDBConstruct 1–11； UniProt 2833–2843 Author chain I； PDBConstruct 1–11； UniProt 2833–2843 Author chain J； PDBConstruct 1–11； UniProt 2833–2843 Author chain K； PDBConstruct 1–11； UniProt 2833–2843 Author chain L； PDBConstruct 1–11； UniProt 2833–2843

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	3rl7
Deposition date deposition_date	2011-04-19
Structure title title	Crystal structure of hDLG1-PDZ1 complexed with APC
Keywords keywords	PDZ-ligand complex, MEMBRANE PROTEIN-SIGNALING PROTEIN complex; MEMBRANE PROTEIN/SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.71 Å
Radius of gyration Rg (electron density) rg_electron	28.57 Å
Forward intensity I(0) i0	64440300.00
Molecular weight molecular_weight	61062.0 kDa
Excluded volume excluded_volume	76044 Å³
Envelope volume envelope_volume	107540 Å³
Hydration-shell volume shell_volume	31334 Å³
Envelope diameter envelope_diameter	87.1 Å
Shell Rg shell_rg	36.29 Å
Envelope Rg envelope_rg	27.44 Å
Shape Rg shape_rg	28.56 Å
Total Rg total_rg	29.45 Å
Total atoms total_atoms	4295
Residues n_residues	563
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	84.7 Å
Rg (real space) rg_real	29.49 Å
Rg uncertainty (real space) rg_real_error	0.45 Å
I(0) (real space) i0_real	6.4440e+07
I(0) uncertainty (real space) i0_real_error	9.1020e+05
Rg (reciprocal space) rg_reciprocal	29.59 Å
I(0) (reciprocal space) i0_reciprocal	64450000.0000
Solution quality estimate total_estimate	0.9020
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	43.1 Å
Skewness Skewness skewness	-0.098
Kurtosis Kurtosis kurtosis	-0.669
Angular range angular_range	— – 0.2650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	25060000.0000
Real-space data points n_real_points	54
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.939; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.996; Smooth: 0.910

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Disks large homolog 1
Molecular weight formula_weight	11865.4 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A,C,D,E,F
Atom count atom_count	4352

MGHHHHHHMYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRKPVSEKI

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	11-mer peptide from Adenomatous polyposis coli protein
Molecular weight formula_weight	1207.3 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L

RHSGSYLVTSV

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	57

▼

7. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (9 domains)

Domain ID domain_id	d3rl7a_
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d3rl7b1
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d3rl7b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3rl7c_
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d3rl7d1
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d3rl7d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d3rl7e_
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d3rl7f1
Class class	b — All beta proteins
Fold Fold fold	b.36 — PDZ domain-like
Superfamily Superfamily superfamily	b.36.1 — PDZ domain-like
Family Family family	b.36.1.1 — PDZ domain

Domain ID domain_id	d3rl7f2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (6 domains)

Domain ID domain_id	3rl7A00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	3rl7B00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	3rl7C00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	3rl7D00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	3rl7E00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

Domain ID domain_id	3rl7F00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	42 — Pdz3 Domain
Homologous superfamily homologous superfamily	10 — PDZ domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	105.627 Å
Unit-cell length b length_b	105.627 Å
Unit-cell length c length_c	50.830 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 3
Space-group number int_tables_number	143
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	50.000 Å
R factor r_factor	0.1944
R_work r_work	0.1925
R_free r_free	0.2314

fit	/app/data/saxs_computation/rl/3rl7/3rl7.fit
pddf	/app/data/pr_computation/rl/3rl7/3rl7.pr.out
profile	/app/data/saxs_computation/rl/3rl7/3rl7.dat

Crystal structure of hDLG1-PDZ1 complexed with APC

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disks large homolog 1

State in the Current Structure

Other States of the Same Protein in the Database

11-mer peptide from Adenomatous polyposis coli protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (9 domains)

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)