SAXSdb — 8cn3

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disks large homolog 1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 260–371	Not recorded	GLU-THR-GLU-VAL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M Bis-Tris pH 5.5, 0.075M (NH4)2SO4, 24% PEG3350	Resolution 2.71 Å R-free 0.259
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 195–306	Not recorded	GLU-THR-GLU-VAL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M Bis-Tris pH 5.5, 0.075M (NH4)2SO4, 24% PEG3350	Resolution 2.71 Å R-free 0.259

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8CN3	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1PDR CRYSTAL STRUCTURE OF THE THIRD PDZ DOMAIN FROM THE HUMAN HOMOLOG OF DISCS LARGE PROTEIN Deposited 1996-07-26	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 457–555（99 aa） Fragment：PDZ3 DOMAIN, DHR3 DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å R-free 0.271
2M3M Solution structure of a complex consisting of hDlg/SAP-97 residues 318-406 and HPV51 oncoprotein E6 residues 141-151 Deposited 2013-01-22	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 318–406（89 aa） Fragment：hDlgPDZ2, UNP residues 318-406	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 20；Pressure ambient NMR sample composition 0.8 mM [U-100% 13C; U-100% 15N] hDlgPDZ2, 2.0 mM E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.8 mM [U-100% 13C; U-100% 15N] hDlgPDZ2, 2.0 mM E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 100% D2O \| 100% D2O NMR sample composition 3.12 mM hDlgPDZ2, 1.25 mM [U-100% 13C; U-100% 15N] E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 100% D2O \| 100% D2O NMR sample composition 3.12 mM hDlgPDZ2, 1.25 mM [U-100% 13C; U-100% 15N] E6CT11, 20 mM sodium phosphate, 4 mM TCEP, 0.05 w/v sodium azide, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2OQS Structure of the hDLG/SAP97 PDZ2 in complex with HPV-18 papillomavirus E6 peptide Deposited 2007-02-01	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 318–405（88 aa） Fragment：second PDZ domain, residues 318-406	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR measurement conditions pH 6.5；293 K；Ionic strength (raw mmCIF value) 28.2 mM；Pressure ambient NMR sample composition 2mM hDLG/SAP97 PDZ2 domain, 3mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 99.5% D2O \| 99.5% D2O NMR sample composition 2mM hDLG/SAP97 PDZ2 domain U-15N, 3mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain U-15N, 13C, 3 mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20 mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain, U-15N, U-10%13C, 3 mM HPV-18 E6 peptide, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5 \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain, U-15N, 3 mM HPV-18 E6 peptide, 5% C8E5, C8E5/n-octanol 0.87, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5, 90% H2O, 10% D2O \| 90% H2O/10% D2O NMR sample composition 2 mM hDLG/SAP97 PDZ2 domain, U-15N, 3 mM HPV-18 E6 peptide, 10 mg/ml pf1 phage, 4 mM TCEP, 20 uM DSS, 20mM phosphate buffer, pH 6.5,90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
2X7Z Crystal Structure of the SAP97 PDZ2 I342W C378A mutant protein domain Deposited 2010-03-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 260–356（97 aa） Fragment：PDZ2 DOMAIN, RESIDUES 260-356	Mutation：YES	NH4 AMMONIUM ION × 2 IMD IMIDAZOLE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.4；VAPOR DIFFUSION, 100MM TRIS-HCL PH 8.4, 2.4M AMMONIUM SULPHATE	Resolution 2.00 Å R-free 0.232
3LRA Structural Basis for Assembling a Human Tripartite Complex Dlg1-MPP7-Mals3 Deposited 2010-02-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–65（64 aa） Fragment：L27 domain, L27 1/2 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；10% PEG 8000, 0.2M MgCl2, 0.1M Guanidine HCl, 0.1M Tris-HCl, pH7.0, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.95 Å R-free 0.284
3RL7 Crystal structure of hDLG1-PDZ1 complexed with APC Deposited 2011-04-19	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 220–317（98 aa） Fragment：UNP RESIDUES 220-317	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3RL7 Crystal structure of hDLG1-PDZ1 complexed with APC Deposited 2011-04-19	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 220–317（98 aa） Fragment：UNP RESIDUES 220-317	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3RL7 Crystal structure of hDLG1-PDZ1 complexed with APC Deposited 2011-04-19	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 220–317（98 aa） Fragment：UNP RESIDUES 220-317	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3RL7 Crystal structure of hDLG1-PDZ1 complexed with APC Deposited 2011-04-19	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 220–317（98 aa） Fragment：UNP RESIDUES 220-317	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3RL7 Crystal structure of hDLG1-PDZ1 complexed with APC Deposited 2011-04-19	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 220–317（98 aa） Fragment：UNP RESIDUES 220-317	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3RL7 Crystal structure of hDLG1-PDZ1 complexed with APC Deposited 2011-04-19	Different construct Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 220–317（98 aa） Fragment：UNP RESIDUES 220-317	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.30 Å R-free 0.231
3RL8 Crystal structure of hDLG1-PDZ2 complexed with APC Deposited 2011-04-19	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain B 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain C 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain D 315–410（96 aa） Fragment：UNP RESIDUES 315-410 Chain E 315–410（96 aa） Fragment：UNP RESIDUES 315-410	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；287 K；0.8M Na2HPO4, 0.9M KH2PO4, pH 7.5, vapor diffusion, hanging drop, temperature 287K	Resolution 2.20 Å R-free 0.245
4AMH Influence of circular permutation on the folding pathway of a PDZ domain Deposited 2012-03-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 327–405（79 aa） Fragment：PDZ2 DOMAIN Chain A 315–326（12 aa） Fragment：PDZ2 DOMAIN Chain B 327–405（79 aa） Fragment：PDZ2 DOMAIN Chain B 315–326（12 aa） Fragment：PDZ2 DOMAIN	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	TRS 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；SITTING DROP VAPOR DIFFUSION, 0.1 M MES PH 6.0, 2.4 M AMMONIUM SULFATE	Resolution 2.30 Å R-free 0.268
4G69 Structure of the Human Discs Large 1 PDZ2 - Adenomatous Polyposis Coli Cytoskeletal Polarity Complex Deposited 2012-07-18	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 310–407（98 aa） Fragment：PDZ2, UNP residues 310-407	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.25；300 K；Protein solution: 1.4 mM Dlg1 PDZ2, 1.7 mM APC, 100 mM NaCl, 25 mM Tris pH 7.0, 0.1% B-ME Well: 200 mM sodium acetate, 100 mM sodium cacodylate pH 6.25, 28% PEG 8000 Drop = 1:1 protein:well solution , VAPOR DIFFUSION, HANGING DROP, temperature 300K	Resolution 2.00 Å R-free 0.183
7PC3 The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1 Deposited 2021-08-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 314–413（100 aa）	Not recorded	CA CALCIUM ION × 4 GOL GLYCEROL × 4 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Lithium sulfate, 0.1 M bis-Tris pH 5.5, 25% w/v PEG 3350	Resolution 1.95 Å R-free 0.201
8CN1 hDLG1-PDZ1 in complex with a TAX1 peptide from HTLV-1 Deposited 2023-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain A 219–311（93 aa） Chain B 219–311（93 aa） Chain C 219–311（93 aa） Chain D 219–311（93 aa） Chain E 219–311（93 aa） Chain F 219–311（93 aa） Chain G 219–311（93 aa） Chain H 219–311（93 aa） Chain I 219–311（93 aa） Chain J 219–311（93 aa） Chain K 219–311（93 aa） Chain L 219–311（93 aa）	Not recorded	SO4 SULFATE ION × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M Bis-Tris pH 5.5, 0.18 M (NH4)2SO4, 24% PEG3350	Resolution 2.09 Å R-free 0.246

11 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DLG1_HUMAN
Isoform	Q12959-5
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 6–117； UniProt 260–371 Author chain B； PDBConstruct 6–117； UniProt 195–306

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8cn3
Deposition date deposition_date	2023-02-21
Structure title title	hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1
Keywords keywords	HTLV-1; Tax-1; hDLG1; PBM, protein protein interaction, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	20.90 Å
Radius of gyration Rg (electron density) rg_electron	20.12 Å
Forward intensity I(0) i0	6699100.00
Molecular weight molecular_weight	19115.0 kDa
Excluded volume excluded_volume	24056 Å³
Envelope volume envelope_volume	29146 Å³
Hydration-shell volume shell_volume	13445 Å³
Envelope diameter envelope_diameter	74.0 Å
Shell Rg shell_rg	24.21 Å
Envelope Rg envelope_rg	20.07 Å
Shape Rg shape_rg	20.13 Å
Total Rg total_rg	20.79 Å
Total atoms total_atoms	1343
Residues n_residues	187
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	75.2 Å
Rg (real space) rg_real	21.12 Å
Rg uncertainty (real space) rg_real_error	0.58 Å
I(0) (real space) i0_real	6.6990e+06
I(0) uncertainty (real space) i0_real_error	9.2840e+04
Rg (reciprocal space) rg_reciprocal	21.08 Å
I(0) (reciprocal space) i0_reciprocal	6699000.0000
Solution quality estimate total_estimate	0.7733
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	18.5 Å
Skewness Skewness skewness	0.528
Kurtosis Kurtosis kurtosis	-0.389
Angular range angular_range	— – 0.3800 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1724000.0000
Real-space data points n_real_points	70
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.503; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.549; Smooth: 0.990

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Disks large homolog 1
Molecular weight formula_weight	12381.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1368

GPLGSKPVSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Disks large homolog 1
Molecular weight formula_weight	12383.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GPLGSKPVSEMIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNS

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	GLU-THR-GLU-VAL
Molecular weight formula_weight	476.5 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

ETEV

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	19

▶

8. Citations (1)

▶

Unit-cell length a length_a	33.349 Å
Unit-cell length b length_b	53.569 Å
Unit-cell length c length_c	61.129 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.33 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	monoclinic

Resolution resolution	2.710 Å
Low-resolution limit resolution_low	40.260 Å
R factor r_factor	0.1901
R_work r_work	0.1865
R_free r_free	0.2591

fit	/app/data/saxs_computation/cn/8cn3/8cn3.fit
pddf	/app/data/pr_computation/cn/8cn3/8cn3.pr.out
profile	/app/data/saxs_computation/cn/8cn3/8cn3.dat

hDLG1-PDZ2 in complex with a TAX1 peptide from HTLV-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disks large homolog 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)