SAXSdb — 8czo

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mucosa-associated lymphoid tissue lymphoma translocation protein 1

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	B-cell lymphoma/leukemia 10 × 22 （O95999）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MALT1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–94； UniProt 29–122 Author chain b； PDBConstruct 1–94； UniProt 29–122 Author chain c； PDBConstruct 1–94； UniProt 29–122 Author chain d； PDBConstruct 1–94； UniProt 29–122 Author chain e； PDBConstruct 1–94； UniProt 29–122 Author chain f； PDBConstruct 1–94； UniProt 29–122 Author chain g； PDBConstruct 1–94； UniProt 29–122 Author chain h； PDBConstruct 1–94； UniProt 29–122 Author chain i； PDBConstruct 1–94； UniProt 29–122 Author chain j； PDBConstruct 1–94； UniProt 29–122 Author chain k； PDBConstruct 1–94； UniProt 29–122 Author chain l； PDBConstruct 1–94； UniProt 29–122 Author chain m； PDBConstruct 1–94； UniProt 29–122 Author chain n； PDBConstruct 1–94； UniProt 29–122 Author chain o； PDBConstruct 1–94； UniProt 29–122 Author chain p； PDBConstruct 1–94； UniProt 29–122 Author chain q； PDBConstruct 1–94； UniProt 29–122 Author chain r； PDBConstruct 1–94； UniProt 29–122 Author chain s； PDBConstruct 1–94； UniProt 29–122 Author chain t； PDBConstruct 1–94； UniProt 29–122 Author chain u； PDBConstruct 1–94； UniProt 29–122 Author chain v； PDBConstruct 1–94； UniProt 29–122

B-cell lymphoma/leukemia 10

Homo sapiens

UniProt O95999

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 44	Mucosa-associated lymphoid tissue lymphoma translocation protein 1 × 22 （Q9UDY8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	BCL10_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–106； UniProt 10–115 Author chain B； PDBConstruct 1–106； UniProt 10–115 Author chain C； PDBConstruct 1–106； UniProt 10–115 Author chain D； PDBConstruct 1–106； UniProt 10–115 Author chain E； PDBConstruct 1–106； UniProt 10–115 Author chain F； PDBConstruct 1–106； UniProt 10–115 Author chain G； PDBConstruct 1–106； UniProt 10–115 Author chain H； PDBConstruct 1–106； UniProt 10–115 Author chain I； PDBConstruct 1–106； UniProt 10–115 Author chain J； PDBConstruct 1–106； UniProt 10–115 Author chain K； PDBConstruct 1–106； UniProt 10–115 Author chain L； PDBConstruct 1–106； UniProt 10–115 Author chain M； PDBConstruct 1–106； UniProt 10–115 Author chain N； PDBConstruct 1–106； UniProt 10–115 Author chain O； PDBConstruct 1–106； UniProt 10–115 Author chain P； PDBConstruct 1–106； UniProt 10–115 Author chain Q； PDBConstruct 1–106； UniProt 10–115 Author chain R； PDBConstruct 1–106； UniProt 10–115 Author chain S； PDBConstruct 1–106； UniProt 10–115 Author chain T； PDBConstruct 1–106； UniProt 10–115 Author chain U； PDBConstruct 1–106； UniProt 10–115 Author chain V； PDBConstruct 1–106； UniProt 10–115

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8czo
Deposition date deposition_date	2022-05-25
Structure title title	Cryo-EM structure of BCL10 CARD - MALT1 DD filament
Keywords keywords	filament, CBM complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8czo__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8czo__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8czo__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	54.52 Å
Rg (electron density)	54.23 Å
Total Rg	54.58 Å
Atom count	34518
Residues	4268
Excluded volume	618780 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8czo__assembly_1__model_1`	44-meric （44）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Mucosa-associated lymphoid tissue lymphoma translocation protein 1
Molecular weight formula_weight	10615.4 kDa
EC 编号 ec_number	3.4.22.-
Source method src_method	man
Copy count entity_count	22

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v
Atom count atom_count	34518

TLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia phage EcSzw-2

Entity 2 Entity 2 polymer

Description description	B-cell lymphoma/leukemia 10
Molecular weight formula_weight	12614.6 kDa
Source method src_method	man
Copy count entity_count	22

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V

EEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia phage EcSzw-2

▶

Resolution resolution	4.30 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	23000

Cryo-EM structure of BCL10 CARD - MALT1 DD filament

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mucosa-associated lymphoid tissue lymphoma translocation protein 1

State in the Current Structure

Other States of the Same Protein in the Database

B-cell lymphoma/leukemia 10

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8czo__assembly_1__model_1

8czo__assembly_1__model_1 | I(q)

8czo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of BCL10 CARD - MALT1 DD filament

1. Protein Identity and Related Structures Protein Identity & Related Structures

Mucosa-associated lymphoid tissue lymphoma translocation protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

B-cell lymphoma/leukemia 10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8czo__assembly_1__model_1

8czo__assembly_1__model_1 | I(q)

8czo__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)