SAXSdb — 8dmi

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glycoprotein G1

Lymphocytic choriomeningitis virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6 其他Polymer 18	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 18 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	GLYC_LYCVA
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 18–225； UniProt 58–265 Author chain B； PDBConstruct 18–225； UniProt 58–265 Author chain C； PDBConstruct 18–225； UniProt 58–265 Author chain a； PDBConstruct 1–165； UniProt 266–430 Author chain b； PDBConstruct 1–165； UniProt 266–430 Author chain c； PDBConstruct 1–165； UniProt 266–430

Glycoprotein G2,Cobalamin adenosyltransferase-like domain-containing protein trimerization tag

Lymphocytic choriomeningitis virus

UniProt Q9HIA7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Heteromer	Protein 6 其他Polymer 18	Glycoprotein G1 × 3 （P09991） 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 18 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9HIA7_THEAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a； PDBConstruct 170–318； UniProt 23–171 Author chain b； PDBConstruct 170–318； UniProt 23–171 Author chain c； PDBConstruct 170–318； UniProt 23–171

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8dmi
Deposition date deposition_date	2022-07-08
Structure title title	Lymphocytic choriomeningitis virus glycoprotein
Keywords keywords	Viral glycoprotein, arenavirus, LCMV, GP, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8dmi__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8dmi__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8dmi__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	30.47 Å
Rg (electron density)	29.32 Å
Total Rg	30.17 Å
Atom count	8259
Residues	951
Excluded volume	146680 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8dmi__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Glycoprotein G1
Molecular weight formula_weight	25521.2 kDa
Mutation mutation	G207C, L264R, A265R
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	8259

MKLCILLAVVAFVGLSLGMYGLKGPDIYKGVYQFKSVEFDMSHLNLTMPNACSANNSHHYISMGTSGLELTFTNDSIISHNFCNLTSAFNKKTFDHTLMSIVSSLHLSIRGNSNYKAVSCDFNNGITIQYNLTFSDAQSAQSQCRTFRGRVLDMFRTAFGGKYMRSCWGWTGSDGKTTWCSQTSYQYLIIQNRTWENHCTYAGPFGMSRILLSQEKTKFLTRRRR

Source Source

Source organism organism	Lymphocytic choriomeningitis virus
NCBI taxonomy ID ncbi_taxonomy_id	11623
Host organism host_organism	Drosophila melanogaster

Entity 2 Entity 2 polymer

Description description	Glycoprotein G2,Cobalamin adenosyltransferase-like domain-containing protein trimerization tag
Molecular weight formula_weight	42166.8 kDa
Mutation mutation	E334P,G366C,S398A
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c

GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDEEFCDMLRLIDYNKAALSKFKPDVESALHLFKTTVNSLISDQLLMRNHLRDLMCVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGAYLNETHFSDQIEQEADNMITEMLRKDYIKRQGLEGGSPVVEVQGTIDELNSFIGYALVLSRWDDIRNDLFRIQNDLFVLGEDVSTGGKGRTVTREMIDYLEARVKEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIVAASKLTEINKNVLIYANRLSSILFMHALISNKRLNIPEKIWALEVDDDDKAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKGSGGLNDIFEAQKIEWHE

Source Source

Source organism organism	Lymphocytic choriomeningitis virus
NCBI taxonomy ID ncbi_taxonomy_id	11623
Host organism host_organism	Drosophila melanogaster

Entity 3 Entity 3 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	18

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	syn
Copy count entity_count	6

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.26 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	61205

Lymphocytic choriomeningitis virus glycoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glycoprotein G1

State in the Current Structure

Other States of the Same Protein in the Database

Glycoprotein G2,Cobalamin adenosyltransferase-like domain-containing protein trimerization tag

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8dmi__assembly_1__model_1

8dmi__assembly_1__model_1 | I(q)

8dmi__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 branched

Entity 4 Entity 4 non-polymer

7. Citations (1)

Lymphocytic choriomeningitis virus glycoprotein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Glycoprotein G1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Glycoprotein G2,Cobalamin adenosyltransferase-like domain-containing protein trimerization tag

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8dmi__assembly_1__model_1

8dmi__assembly_1__model_1 | I(q)

8dmi__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 branched

Entity 4 Entity 4 non-polymer

7. Citations (1)