8fvy

40S subunit of the Giardia lamblia 80S ribosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

40S ribosomal protein SA

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RSSA_GIAIC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–245； UniProt 1–245

40S ribosomal protein S3a

OrganismNot specified

UniProt A8BS79

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3A_GIAIC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain B； PDBConstruct 1–248； UniProt 1–248

Ribosomal protein S2

OrganismNot specified

UniProt A8BMZ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BMZ1_GIAIC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain C； PDBConstruct 1–242； UniProt 1–242

Ribosomal protein S3

OrganismNot specified

UniProt A8B8Z2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B8Z2_GIAIC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain D； PDBConstruct 1–217； UniProt 1–217

40S ribosomal protein S4

OrganismNot specified

UniProt A8BFE3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BFE3_GIAIC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain E； PDBConstruct 1–268； UniProt 1–268

SSU ribosomal protein S7P (Fragment)

OrganismNot specified

UniProt V6T8P6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V6T8P6_GIAIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain F； PDBConstruct 1–190； UniProt 23–212

40S ribosomal protein S6

OrganismNot specified

UniProt A8B6L8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B6L8_GIAIC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain G； PDBConstruct 1–248； UniProt 1–248

40S ribosomal protein S7

OrganismNot specified

UniProt V6TBA3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V6TBA3_GIAIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain H； PDBConstruct 1–201； UniProt 1–201

40S ribosomal protein S8

OrganismNot specified

UniProt A8B252

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B252_GIAIC
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–174； UniProt 1–174

Ribosomal protein S9

OrganismNot specified

UniProt A8BKS8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BKS8_GIAIC
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain J； PDBConstruct 1–189； UniProt 1–189

Ribosomal protein S10B

OrganismNot specified

UniProt A8BRX3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BRX3_GIAIC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain K； PDBConstruct 1–134； UniProt 1–134

SSU ribosomal protein S17P

OrganismNot specified

UniProt V6TF82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V6TF82_GIAIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L； PDBConstruct 1–199； UniProt 34–232

Ribosomal protein S13

OrganismNot specified

UniProt A8BE02

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BE02_GIAIC
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain N； PDBConstruct 1–154； UniProt 1–154

Ribosomal protein S14

OrganismNot specified

UniProt E2RU83

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	E2RU83_GIAIC
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain O； PDBConstruct 1–145； UniProt 1–145

Ribosomal protein S15

OrganismNot specified

UniProt A8BBP3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BBP3_GIAIC
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain P； PDBConstruct 1–145； UniProt 1–145

Ribosomal protein S16

OrganismNot specified

UniProt A8BKC6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BKC6_GIAIC
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain Q； PDBConstruct 1–158； UniProt 1–158

Ribosomal protein S17

OrganismNot specified

UniProt A8BRG5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BRG5_GIAIC
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain R； PDBConstruct 1–137； UniProt 1–137

Ribosomal protein S18

OrganismNot specified

UniProt A8BZ58

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BZ58_GIAIC
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain S； PDBConstruct 1–154； UniProt 1–154

SSU ribosomal protein S19E (Fragment)

OrganismNot specified

UniProt V6TE85

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V6TE85_GIAIN
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain T； PDBConstruct 1–158； UniProt 1–158

Ribosomal protein S20

OrganismNot specified

UniProt A8B4G0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B4G0_GIAIC
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain U； PDBConstruct 1–126； UniProt 1–126

40S ribosomal protein S21

OrganismNot specified

UniProt A8B484

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B484_GIAIC
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain V； PDBConstruct 1–89； UniProt 1–89

SSU ribosomal protein S8P (Fragment)

OrganismNot specified

UniProt V6TFI0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V6TFI0_GIAIN
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain W； PDBConstruct 1–130； UniProt 12–141

SSU ribosomal protein S12P

OrganismNot specified

UniProt V6T9I6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	V6T9I6_GIAIN
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain X； PDBConstruct 1–143； UniProt 12–154

Ribosomal protein S24

OrganismNot specified

UniProt A8B593

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B593_GIAIC
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain Y； PDBConstruct 1–132； UniProt 1–132

40S ribosomal protein S25

OrganismNot specified

UniProt A8B8H7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B8H7_GIAIC
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain Z； PDBConstruct 1–88； UniProt 1–88

40S ribosomal protein S26

OrganismNot specified

UniProt A8BQZ7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BQZ7_GIAIC
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain a； PDBConstruct 1–109； UniProt 1–109

Ribosomal protein S27

OrganismNot specified

UniProt A8BJL1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BJL1_GIAIC
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain b； PDBConstruct 1–124； UniProt 1–124

Ribosomal protein S28

OrganismNot specified

UniProt A8B4F3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B4F3_GIAIC
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain c； PDBConstruct 1–64； UniProt 1–64

Ribosomal protein S29A

OrganismNot specified

UniProt A8B7H6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8B7H6_GIAIC
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain d； PDBConstruct 1–137； UniProt 1–137

Ribosomal protein S27a

OrganismNot specified

UniProt A8BNY1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BNY1_GIAIC
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain f； PDBConstruct 1–137； UniProt 1–137

Ribosomal protein S12

OrganismNot specified

UniProt A8BUG8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 40S ribosomal protein S30 × 1 （A0A644F843） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A8BUG8_GIAIC
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain M； PDBConstruct 1–125； UniProt 1–125

40S ribosomal protein S30

OrganismNot specified

UniProt A0A644F843

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 32 RNA 2	18S rRNA × 1 40S ribosomal protein SA × 1 （A8BE86） 40S ribosomal protein S3a × 1 （A8BS79） Ribosomal protein S2 × 1 （A8BMZ1） Ribosomal protein S3 × 1 （A8B8Z2） 40S ribosomal protein S4 × 1 （A8BFE3） SSU ribosomal protein S7P (Fragment) × 1 （V6T8P6） 40S ribosomal protein S6 × 1 （A8B6L8） 40S ribosomal protein S7 × 1 （V6TBA3） 40S ribosomal protein S8 × 1 （A8B252） Ribosomal protein S9 × 1 （A8BKS8） Ribosomal protein S10B × 1 （A8BRX3） SSU ribosomal protein S17P × 1 （V6TF82） Ribosomal protein S13 × 1 （A8BE02） Ribosomal protein S14 × 1 （E2RU83） Ribosomal protein S15 × 1 （A8BBP3） Ribosomal protein S16 × 1 （A8BKC6） Ribosomal protein S17 × 1 （A8BRG5） Ribosomal protein S18 × 1 （A8BZ58） SSU ribosomal protein S19E (Fragment) × 1 （V6TE85） Ribosomal protein S20 × 1 （A8B4G0） 40S ribosomal protein S21 × 1 （A8B484） SSU ribosomal protein S8P (Fragment) × 1 （V6TFI0） SSU ribosomal protein S12P × 1 （V6T9I6） Ribosomal protein S24 × 1 （A8B593） 40S ribosomal protein S25 × 1 （A8B8H7） 40S ribosomal protein S26 × 1 （A8BQZ7） Ribosomal protein S27 × 1 （A8BJL1） Ribosomal protein S28 × 1 （A8B4F3） Ribosomal protein S29A × 1 （A8B7H6） Ribosomal protein S27a × 1 （A8BNY1） tRNA × 1 Ribosomal protein S12 × 1 （A8BUG8） MAGNESIUM ION × 23 emetine × 1 ZINC ION × 1 water × 29	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A644F843_GIAIC
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain e； PDBConstruct 1–69； UniProt 1–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8fvy
Deposition date deposition_date	2023-01-20
Structure title title	40S subunit of the Giardia lamblia 80S ribosome
Keywords keywords	Giardia lamblia, Ribosome structure, Translation, parasite, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8fvy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8fvy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8fvy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	71.40 Å
Rg (electron density)	73.36 Å
Total Rg	73.21 Å
Atom count	119187
Residues	5862
Excluded volume	1078700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8fvy__assembly_1__model_1`	34-meric （34）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (38)

Entity 1 Entity 1 polymer

Description description	18S rRNA
Molecular weight formula_weight	470516.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2
Atom count atom_count	119930

CAUCCGGUCGAUCCUGCCGGAGCGCGACGCUCUCCCCAAGGACGAAGCCAUGCAUGCCCGCUCACCCGGGACGCGGCGGACGGCUCAGGACAACGGUUGCACCCCCCGCGGCGGUCCCUGCUAGCCGGACACCGCUGGCAACCCGGCGCCAAGACGUGCGCGCAAGGGCGGGCGCCCGCGGGCGAGCAGCGUGACGCAGCGACGGCCCGCCCGGGCUUCCGGGGCAUCACCCGGUCGGCGCGGUCGCGGCGCGCCGAGGGCCCGACGCCUGGCGGAGAAUCAGGGUUCGACUCCGGAGAGCGGGCCUGCGAGACGGCCCGCACAUCCAAGGACGGCAGCAGGCGCGGAACUUGCCCAAUGCGCGGCGCGCGAGGCAGCGACGGGGAGCGCGCGAGCGAGGCGGGCCCACAGCCCCCGCCGCGGAGCCGAGGGCAAGGUCUGGUGCCAGCAGCCGCGGUAAUUCCAGCUCGGCGAGCGUCGCGCGGCGCUGCUGCAGUUGAAACGCCCGUAGUUGGCCCCCCGCCGCCACGAGGAAACGGGAGCGCUCCAGGCAGGCCCGUUGGACCCGCCGCGUGGGACCGCGCAGCGGGCGCGGCGCGCCGCGGCAGCCCCGAGGAGAGCGGGCGGGGGCACCGGUACCGGCCGGGGACGGGUGAAACAGGAUGAUCCCGCCGAGACCGCCGGCCGCGCAGGCGCCUGCCAAGACCGCCUCUGUCAAUCAAGGGCGAAGGCCGGGGGCUAGAAGGCGAUCAGACACCACCGUAUUCCCGGCCGUAAACGGUGCCGCCCCGCGGCCGGCGCGCGCGUCCCGCCGGCCGCCCAGGGAAACCGGGAGGCUCCGGGCUCUGGGGGGAGUAUGGCCGCAAGGCUGAAACUUGAAGGCAUUGACGGAGGGGUACCACCAGACGUGGAGUCUGCGGCUCAAUCUGACCCAACGCGCGCACCUCACCAGGCCCGGACGCGCGGAGGACCGACAGCCGGGCGCGCUUUCGCGAUCGCGCGGGCGGUGGUGCAUGGCCGCUCCCAGCCCGUGGCGCGAGCCGUCUGCUCCAUUGCGACAACGAGCGAGACCCCGGCCGCGGGCGCCGCGGGACGGCCCGCGCGAGCGGGAGGACGGCGGGGCGAUAGCAGGUCUGUGAUGCCCUCAGACGCCCUGGGCCGCACGCGCGCUACACUGGCGGGGCCAGCCGGCGCCCGCGAGGACGCGCGGAGCCCCCGCCGUGGCCGGGACCGCGGGCUGGAACGCCCCCGCGCACCAGGAAUGUCUUGUAGGCGCCCGCCCCCACCGCGCGCCGGACGCGUCCCUGCCCCUUGUACACACCGCCCGUCGCUCCUACCGACUGGGCGCGGCGGCGAGCGCCCCGGACGCGCGAAGGGCCGCGAGCCCCCGCGCCUGGAGGAAGGAGAAGUCGUAACAAGGUAUCCGUAGGUGAACCUGCGGAUGGAUCCCU

Entity 2 Entity 2 polymer

Description description	40S ribosomal protein SA
Molecular weight formula_weight	28101.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MSTEKTSQASKEYQLKEADVKKMLVATTHLGVRNIDRRMQFYIFDRQKDGTFVFNLQKVWAKIVFAARILVTIDDPAEIAVVANRPDAQRAILKFCKYTHATAFPGRFIPGNFTNRMNPNYCEPRLLLVNDPVVDRQAILEASYVNIPTISLCNSDANLKFIDVAIPCNNKTPMSIGLIYWLLAREVLRLKGSISRTEEWDVKPDLFVALPEEIPDEEESEDFYDDDEEEDEEFSAGNGNLFDEY

Entity 3 Entity 3 polymer

Description description	40S ribosomal protein S3a
Molecular weight formula_weight	28413.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAIGGNKTGKKKITQRKNPDPYLKKEWYPVIAPAHFKSRHIGQTPVTKTAGLRVATDVINHRVYEVNLGDLNPGAEDLNGNTKFYLQTQLVSDGKCLTNFHGMDITRHKYGSLFRKGCDCIDVFMDIPTTDGYLLRVFVIAFTDRFRFQRRKNCHVKGRVIRMMRAGIYETLHNELGKVSIPVLVTKLSNFEVNAKLTEALQKITMCRDVMIRRVKVVKRPRNTMELLSTMHDSNQVRNLAEGQSIQQ

Entity 4 Entity 4 polymer

Description description	Ribosomal protein S2
Molecular weight formula_weight	26765.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MQAESAPRPERPERGERGPRQMEEEEWHPSTKLGRLVKAGKIESLYDIFKYSLPIKETEIIDYFFPKSELAEEVCNIMSVQKQTTAGQRTRFRAHVIVGNRDGFIGYGAGVSKEVANAIKKAAKNARLNIVPVRRGFWGGKLGDPHTVSSKLSGKCGSVRVRLIPAPRGAGIVASPTVAKVLEFAGVSDVFTRQSGHSRTLMNSVGAVYNALKSSYSILTPDLWKKEQLDHVQDIRTMSLAD

Entity 5 Entity 5 polymer

Description description	Ribosomal protein S3
Molecular weight formula_weight	24779.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MPRIVRRDEENVYYSKYLNDCIMEAELHEFFSRELVDAGYASCSLCRTIDSICVIIQCAEPEVVMGDNHYRLHKIEYLLAGRFMCDPKNFNIWVDKIIKRGLSAEIMVDNLRAKLEEAMPIRRAAYSIIRTAMRAGAAGCEVIVAGKLRAQRARANKFKEGCLISTGHPKRIFLAEATRHIKMRQGVIGVKVRIYNPNIRGAVMPDKIEIGAFSRQK

Entity 6 Entity 6 polymer

Description description	40S ribosomal protein S4
Molecular weight formula_weight	30464.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MARGVRKHLKRLNAPKHWLLDKMGGIWAPRPTNGPHGLRECIPLILILRNRLHYANTYAETSMILQDKNVLIDGKPRTDPTFPVGFMDVFEIPKVHKTFRVLYDVKGRFTLVPIQSNEAGFKLCRVQKIFLGDKGMPYLSTHDARTIRFPHPDIKTNDTIKINLKTGKIDEWYKFDIGKIVMVTGGRNCGRIGTIQAIDKHMGSYTMIRMKDTEGTEFLTRLCNVFVIGNDSPAVAIPTTKGIRPDIIKNRELRLRSIAKRGGGASYE

Entity 7 Entity 7 polymer

Description description	SSU ribosomal protein S7P (Fragment)
Molecular weight formula_weight	21058.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSLEVALFNKWPLTDVKCQDESLEAYISIDNHSFVPHSAGRWSAKRFRKAKCPVVERLTNSLMMHGRNSGKKLMAMKTVGEAFELINLYTGKNPVQVLVDAVANSGPREDSCRIGKGGQVRRQSVDVSPLRRVNIGIYNIATGARKAAFRKVRPFAECLAEEIMNAAAGADKSYAISQRNSVERIAVSNR

Entity 8 Entity 8 polymer

Description description	40S ribosomal protein S6
Molecular weight formula_weight	28084.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MPKGSFCKVNISNPVTGANKSLMIEDFRKSQTIHGLRMASEFDGAALGEEYAGCTFRITGGNDAQGFPMYQGVLKSQRARLLLRQGAKCYLHRRNGERKRKSIRGCIVGPDLHALSVVLVDAGDKTLPGLTDVVVPKRLVPKRASKIRRLFGLPTTKVDPKDQMLVCELIKELGHEVTLKNGEKKLKYPKVQRVVTDEKYARKQRVIAEKKEIMRKSLQQLEEYKALLSRMGKQHNIRIYKPAKRTVE

Entity 9 Entity 9 polymer

Description description	40S ribosomal protein S7
Molecular weight formula_weight	23073.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MNFHLTRSIPSMTFPAQRKIRKPFEKLSELEKQVAGTLLKLEDDPDLREMGLGTLYISSVKEIAVDGDKKAAVVYVPYPMLQSFQKNSEALILKLEKNHSGHRFIIVANRTIMKNAYVFTGKKSIRRPRSRTMTSVYNCILDDICYPIHVIGKRTLYPAGSNPRLQVVLPKAVYNEVSERTKTYSAVYKALTERDTEFIFM

Entity 10 Entity 10 polymer

Description description	40S ribosomal protein S8
Molecular weight formula_weight	19451.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MGITHDKMYKRSKTGAVQGKWHKKRKYNLGRQPANTKLIVKVTSKKNEGQKISTIRCRGGNIKRRALRLSHGSFAWGSADISHKARILQVVYNSTSNELVRTNTLVKGCVVQIDSAPFKSALSNDTLDKEILDQIRGDHILARISSRPGQVGTADGYILEGPELLFYQKKLAPK

Entity 11 Entity 11 polymer

Description description	Ribosomal protein S9
Molecular weight formula_weight	21699.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MPRISRHRNSSKTYSTPKKPFTKPRLDAELKLCGEYGLKCKREIYRARYMLAKIRRTARNLLTLDENDIKRRFEGAALLRRLHMLGILDEEKDQLDYVLGLRIEDIFKRRLQSVIVESKLAKSVHHARNMIKARHISVGGQIVNIPSYMVRISNTSRVAIADTSSLAPNGKPGRTKRAAARRQSSGDNE

Entity 12 Entity 12 polymer

Description description	Ribosomal protein S10B
Molecular weight formula_weight	15406.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MVHIPKAVYKAVYAHLYENASLALKEYWRVGNVPGITYVDENGKLCNPTYLHVNCIMQSLESRGVVKDTFAWRHHYYLLTEKGEQFIRKELDLTDDVLPTPYSKPSIKPPQYAQCFSSKGKPDRAPQPKPDEAK

Entity 13 Entity 13 polymer

Description description	SSU ribosomal protein S17P
Molecular weight formula_weight	23160.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MSATKDKQQSNAGAKVGGRHPLRPDPDRERRALERAETLRKAAYEMAENQHERAYHKQSQIFQGRFLRKDNARCLRFYKSIGMGYHTPITAINGTYIDKKCPFTGNVSIRGRILRGVVHSAKMQRSIIVRRDYLHFVQKYKRYERRHKHVAAHLSPCFRVKEGDIVTIGECRPLSKTIRFNVIKVEPVSEAAKKRFSPF

Entity 14 Entity 14 polymer

Description description	Ribosomal protein S13
Molecular weight formula_weight	17627.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MGRMHSKGKGISRSAIPYTRAPAPWNKYTPEDVCEQICKLAKKGTPPSRIGLILRDQFAIGQVKNVTGSKIVRILKAKGLAPEIPEDLYCMIKKAVAIRKHLERSRRDKDSKFRLILVESRIHRLARYYRQARRLPPTFRYKSDQAAALLATYA

Entity 15 Entity 15 polymer

Description description	Ribosomal protein S14
Molecular weight formula_weight	15756.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSRKVTYAPENLPAKNNNSEAFAVCHIYAGKNDTFIHVTDLSGRETIGRVSGGMKVKRHCDEPSAYAAMQATQDLIEIITDRGITAVHIKIRADGGTGKRVYGQGGSAAIRALVRGGIKIGRIEDSTPIPTDRTRHKGGRRGRRL

Entity 16 Entity 16 polymer

Description description	Ribosomal protein S15
Molecular weight formula_weight	16728.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTDQVKTRRRGLAQPNFRGVEVEKLATMKITDILPKLNARCRRRIGKHGLSMKHLRFVNKLRLRRAAQPSQKPKIVRTHLRDMIIFPEMIGMTVSVYNGRQFIPVEIKPPMVGRALREYSMSYKIVSHGKVGIGATRSSKFVPLR

Entity 17 Entity 17 polymer

Description description	Ribosomal protein S16
Molecular weight formula_weight	17634.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAKGNRRDLLERNDIEVRERDKYTVHTLGKKKNSVAVAFVKAGKGDILVNNVPLALVRPEILRTKVSEPIMILGESLFKGLDMNIKVAGGGHVSQIYAVRQAISRGVLASVKDEAARSELRAKLVSYDRQLVVSDPRRCEAKKFGGRGARARRQKSYR

Entity 18 Entity 18 polymer

Description description	Ribosomal protein S17
Molecular weight formula_weight	15757.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MGKVRTKTIKRAARKIVENNYESLKPKDFQNNKAICSKRNVAIIPSKRLRNKVAGYVTTLMNRVVKGPVHGISLRLQEEERERRDNYAPKKSEFDVENITVSGATQQMIDSIGFKCMSTSLKVIDPTMRKRARDTRE

Entity 19 Entity 19 polymer

Description description	Ribosomal protein S18
Molecular weight formula_weight	17510.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MTTIVQPNDYRDLLRMFNTNIQGKVVLECALVGIKGIGRRFANVALKKANIDVHKRAGELTAAEEDALMKVLEDPLSHGIPAWMLNRNNDFESGKDMHILVNTIASTHRADLERLRKTRCERGVRHHHNLKVRGQHTKSTGRRGHVVGVQRKKK

Entity 20 Entity 20 polymer

Description description	SSU ribosomal protein S19E (Fragment)
Molecular weight formula_weight	17816.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

VRQRIHIKLKYWSINQLLGMSSVTRVPADVFINSFAAHLKNRGIIKCPAFTDYVKTGVSRQYAPRDADWFYIKAASVIRHFYISGSHSIGVAGLARKYSSLQKGKTTPHHTKRASCKVIRSIVSQFLGQKLLIAGERGRHISPNGRKMVEDFAEGLQK

Entity 21 Entity 21 polymer

Description description	Ribosomal protein S20
Molecular weight formula_weight	14073.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MAESVSTGGVNLADHKDGKDMHQKYTIIVVGKDLKLVERYVKSIVKEGRAFGISGPCRAPVRRLTITTRKSPCGEGTNTWHRFELRMYKRTFWVTCGGNDISTILSKTVVIPGIQVTVEVEEPDNE

Entity 22 Entity 22 polymer

Description description	40S ribosomal protein S21
Molecular weight formula_weight	9686.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MQSDDIGMKNSSGVVVDAYIPRKCSATNRLIGPKDHAAVQLSVARVNDKGKMIENNYVTFAFCGAIRSRGGVDSAFMLLAQEHGLMERL

Entity 23 Entity 23 polymer

Description description	SSU ribosomal protein S8P (Fragment)
Molecular weight formula_weight	14770.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MVRINVLRDALKSICNAQRIGKKQVIVRPSSKVIIEFLQLMQKNGYISDFAVVDNHRSNRIVVNLIGRLNKAGVISPRFDIPANDIEKWVVNLLPSRLFGHIILTTSQGIMDHIEAQHRQIGGKVIGYFY

Entity 24 Entity 24 polymer

Description description	SSU ribosomal protein S12P
Molecular weight formula_weight	15897.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSKTSGLYTARKLRTVRRVNRWADKKYRKAHLGTWLKANPLEGACMARGIVTQKIGISAKQPNSAVRKAVRVQLTKNSKKITAFVPRDGSITYIDNNDEVLVAGFGRAGRAVGDIPGCRFKVIKVAGIGLLALFLRKREKRAR

Entity 25 Entity 25 polymer

Description description	Ribosomal protein S24
Molecular weight formula_weight	14872.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MPEITVKVRKVLNNPLLQRQQCVVDVLHPGCTYESKEAIKAKVAQQLKVADQKNIVLYGFKTSFGGGHTVGFCNAYQNMDALMKYEPGFRKIRCGLIEAPKPVSRKQLKNLKNRRLKKRGTEKATVTLGAKK

Entity 26 Entity 26 polymer

Description description	40S ribosomal protein S25
Molecular weight formula_weight	10121.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MSSKKWTKKAVKEKVDYPTLFADEAAMNEALKFIKNSKCITHTQICERLRVSVALAKRVMRQLVKSGDFAIVSKSSRMTIFKNMTKKE

Entity 27 Entity 27 polymer

Description description	40S ribosomal protein S26
Molecular weight formula_weight	12791.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MPVKRRNNGRSKYNCGHTNIVRCQNCHRCVPKDKVIKRFTIRNIVDNTIADDVLNACVIQGFAIPKLYNKVQYCVSCSIHNHIVRVRSREDRKIRTPPKRFPRNSSQKK

Entity 28 Entity 28 polymer

Description description	Ribosomal protein S27
Molecular weight formula_weight	14117.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MTPFSRFGEHCQLNINHAVYTLKLQTNPNKFKFKSELRGAKVSMNVDLLYPDPVEEQRKHKLKRLVQGPNSYFLEIKCAGCQDIVVVYSHANTPVFCPGCTSQISIPTGGKCAFTSQVERYRQK

Entity 29 Entity 29 polymer

Description description	Ribosomal protein S28
Molecular weight formula_weight	7358.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MPEPINARVIEVLGRTSSRGGITQVKVEFMTGEKRQIIRNVIGPVRKDDILVLMESEREARRLR

Entity 30 Entity 30 polymer

Description description	Ribosomal protein S29A
Molecular weight formula_weight	15499.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d

MRSALDTGVAADRIGRPQTFAELRVDKVDDIGTQRHIEHLGPRKLRNLGSCGAEDLDSRVHPSTIFWPTEADNINLASGVPKKGPSMRETEFCTHIAHKRECRICGNYNSVYRKYGLFICRRCFKENAGKIGFVKLH

Entity 31 Entity 31 polymer

Description description	Ribosomal protein S27a
Molecular weight formula_weight	15134.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f

MLVIVRLQDQTLPFELPAGARASQLSNLLSSSGMAFSLHTQGRVLSEAAELNDKMVIDAFVPADGAGKDKKRKKKAHKTPKKIKHEPKKVRLACLKYYTIKGDTAEPTREYCPNCGPGIRIARHADRCHCGRCGFAK

Entity 32 Entity 32 polymer

Description description	tRNA
Molecular weight formula_weight	23749.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	g

GGGUAAUUGGCGCAGUUGGUUAGCGCGCGGGUCUCAUAAUCCCGAGCUCGUGAGUUCGAUCCGCACAUUCCCCA

Entity 33 Entity 33 polymer

Description description	Ribosomal protein S12
Molecular weight formula_weight	14378.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MADTTRENFLKETFKRIHNMDGLVTGHRQVFKYLERKRAKICFLASDCEEKQYADIVECLCKEYKVHLCKKFTRRTLGELTGQVRCLADSDKIIKVVPASACVIHNFVGMSSGDVDSFLTKLDEQ

Entity 34 Entity 34 polymer

Description description	40S ribosomal protein S30
Molecular weight formula_weight	7932.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e

MARAHGGLTSAGKVRKCTPKKEKKEKPRPPRGRAYKRLLYNKNFVDDTLIHNGRRLGPNNLLIRQKLGF

Entity 35 Entity 35 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	23

Entity 36 Entity 36 non-polymer

Description description	emetine
Molecular weight formula_weight	480.6 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 37 Entity 37 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 38 Entity 38 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	743

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.94 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	289618

40S subunit of the Giardia lamblia 80S ribosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

40S ribosomal protein SA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S3a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein S2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein S3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SSU ribosomal protein S7P (Fragment)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

40S ribosomal protein S8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Ribosomal protein S9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer