8gap

Structure of LARP7 protein p65-telomerase RNA complex in telomerase

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Telomerase reverse transcriptase

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 DNA 1 RNA 1	Telomerase holoenzyme Teb1 subunit × 1 （D2CVN6） Telomerase holoenzyme Teb2 subunit × 1 （A0A0U8TRG9） Telomerase holoenzyme Teb3 subunit × 1 （A0A0U8UFF4） Telomerase associated protein p50 × 1 （D2CVN8） telomere DNA × 1 Telomerase RNA × 1 Telomerase La-related protein p65 × 1 （W7X6T2） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TERT_TETTH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1117； UniProt 1–1117

Telomerase holoenzyme Teb1 subunit

OrganismNot specified

UniProt D2CVN6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 DNA 1 RNA 1	Telomerase reverse transcriptase × 1 （O77448） Telomerase holoenzyme Teb2 subunit × 1 （A0A0U8TRG9） Telomerase holoenzyme Teb3 subunit × 1 （A0A0U8UFF4） Telomerase associated protein p50 × 1 （D2CVN8） telomere DNA × 1 Telomerase RNA × 1 Telomerase La-related protein p65 × 1 （W7X6T2） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	D2CVN6_TETTH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–701； UniProt 1–701

Telomerase holoenzyme Teb2 subunit

OrganismNot specified

UniProt A0A0U8TRG9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 DNA 1 RNA 1	Telomerase reverse transcriptase × 1 （O77448） Telomerase holoenzyme Teb1 subunit × 1 （D2CVN6） Telomerase holoenzyme Teb3 subunit × 1 （A0A0U8UFF4） Telomerase associated protein p50 × 1 （D2CVN8） telomere DNA × 1 Telomerase RNA × 1 Telomerase La-related protein p65 × 1 （W7X6T2） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U8TRG9_TETTH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–269； UniProt 1–269

Telomerase holoenzyme Teb3 subunit

OrganismNot specified

UniProt A0A0U8UFF4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 DNA 1 RNA 1	Telomerase reverse transcriptase × 1 （O77448） Telomerase holoenzyme Teb1 subunit × 1 （D2CVN6） Telomerase holoenzyme Teb2 subunit × 1 （A0A0U8TRG9） Telomerase associated protein p50 × 1 （D2CVN8） telomere DNA × 1 Telomerase RNA × 1 Telomerase La-related protein p65 × 1 （W7X6T2） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U8UFF4_TETTH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–121； UniProt 1–121

Telomerase associated protein p50

OrganismNot specified

UniProt D2CVN8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 DNA 1 RNA 1	Telomerase reverse transcriptase × 1 （O77448） Telomerase holoenzyme Teb1 subunit × 1 （D2CVN6） Telomerase holoenzyme Teb2 subunit × 1 （A0A0U8TRG9） Telomerase holoenzyme Teb3 subunit × 1 （A0A0U8UFF4） telomere DNA × 1 Telomerase RNA × 1 Telomerase La-related protein p65 × 1 （W7X6T2） ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TAP50_TETTS
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain G； PDBConstruct 1–422； UniProt 1–422

Telomerase La-related protein p65

OrganismNot specified

UniProt W7X6T2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 DNA 1 RNA 1	Telomerase reverse transcriptase × 1 （O77448） Telomerase holoenzyme Teb1 subunit × 1 （D2CVN6） Telomerase holoenzyme Teb2 subunit × 1 （A0A0U8TRG9） Telomerase holoenzyme Teb3 subunit × 1 （A0A0U8UFF4） Telomerase associated protein p50 × 1 （D2CVN8） telomere DNA × 1 Telomerase RNA × 1 ZINC ION × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LARP7_TETTS
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–542； UniProt 1–542

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8gap
Deposition date deposition_date	2023-02-23
Structure title title	Structure of LARP7 protein p65-telomerase RNA complex in telomerase
Keywords keywords	La protein, La-related protein, telomerase, ribonucleoprotein, RNA BINDING PROTEIN; RNA BINDING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8gap__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8gap__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8gap__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	49.88 Å
Rg (electron density)	50.35 Å
Total Rg	50.38 Å
Atom count	20630
Residues	2205
Excluded volume	357230 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8gap__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	Telomerase reverse transcriptase
Molecular weight formula_weight	133486.9 kDa
EC 编号 ec_number	2.7.7.49
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	20630

MQKINNINNNKQMLTRKEDLLTVLKQISALKYVSNLYEFLLATEKIVQTSELDTQFQEFLTTTIIASEQNLVENYKQKYNQPNFSQLTIKQVIDDSIILLGNKQNYVQQIGTTTIGFYVEYENINLSRQTLYSSNFRNLLNIFGEEDFKYFLIDFLVFTKVEQNGYLQVAGVCLNQYFSVQVKQKKWYKNNFNMNGKATSNNNQNNANLSNEKKQENQYIYPEIQRSQIFYCNHMGREPGVFKSSFFNYSEIKKGFQFKVIQEKLQGRQFINSDKIKPDHPQTIIKKTLLKEYQSKNFSCQEERDLFLEFTEKIVQNFHNINFNYLLKKFCKLPENYQSLKSQVKQIVQSENKANQQSCENLFNSLYDTEISYKQITNFLRQIIQNCVPNQLLGKKNFKVFLEKLYEFVQMKRFENQKVLDYICFMDVFDVEWFVDLKNQKFTQKRKYISDKRKILGDLIVFIINKIVIPVLRYNFYITEKHKEGSQIFYYRKPIWKLVSKLTIVKLEEENLEKVEEKLIPEDSFQKYPQGKLRIIPKKGSFRPIMTFLRKDKQKNIKLNLNQILMDSQLVFRNLKDMLGQKIGYSVFDNKQISEKFAQFIEKWKNKGRPQLYYVTLDIKKCYDSIDQMKLLNFFNQSDLIQDTYFINKYLLFQRNKRPLLQIQQTNNLNSAMEIEEEKINKKPFKMDNINFPYYFNLKERQIAYSLYDDDDQILQKGFKEIQSDDRPFIVINQDKPRCITKDIIHNHLKHISQYNVISFNKVKFRQKRGIPQGLNISGVLCSFYFGKLEEEYTQFLKNAEQVNGSINLLMRLTDDYLFISDSQQNALNLIVQLQNCANNNGFMFNDQKITTNFQFPQEDYNLEHFKISVQNECQWIGKSIDMNTLEIKSIQKQTQQEINQTINVAISIKNLKSQLKNKLRSLFLNQLIDYFNPNINSFEGLCRQLYHHSKATVMKFYPFMTKLFQIDLKKSKQYSVQYGKENTNENFLKDILYYTVEDVCKILCYLQFEDEINSNIKEIFKNLYSWIMWDIIVSYLKKKKQFKGYLNKLLQKIRKSRFFYLKEGCKSLQLILSQQKYQLNKKELEAIEFIDLNNLIQDIKTLIPKISAKSNQQNTN

Entity 2 Entity 2 polymer

Description description	Telomerase holoenzyme Teb1 subunit
Molecular weight formula_weight	82040.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MKLTKGGSYILKKVDRKQFYQDEEIVMQIKKILGQKTTDCKQYIKCECIDGLGDEALIYFEMLANQNQHLQKNDVIMIQDYLNDKTQNDKIVVLVTRFQFCKASHVQPKTAQKESIQLLNTEKTIIQKSKITKNPAEEVLKFIEVNEKDNSSNSEDMIIEQQKQEIKNNQKEKQSINGFNLEDSYSNISDITNFGGKSNFNIGSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETLSANYVQPLALQPSKQFGNDSIGDSDYSIHNLIEKEESIAQKGYNGQKNNKYRQNNNNSKHTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDDQRKVITYNQEQGVFKKSISINSNDSFEIKPKISYKNNSNQEQRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGKSVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQLINQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENKEFNNEQEIAYKVLKIEKENIKEESKYLLKKLEHLINNNQNN

Entity 3 Entity 3 polymer

Description description	Telomerase holoenzyme Teb2 subunit
Molecular weight formula_weight	30993.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSNRVQGGFDNNSGNNQSAQKQQAEKIPQITVPLNCFMINQIVKAAKENPQAHSGNHYEWYGAFENAIITAKFEFLQSINDSPKIMGKLSDSTGCIEVVIQKSKMSDELPEFVQAYEIELQNNGNRHKYVRAMLKMRKNAQIQLLYFSIVNDANEISRHGLDLCLRYLQRKHGIEDFMHMTNDKAHNNHNASAQKVHYQIDRNQQPKEQVLELMRQILKHNPNDQIPKSKIIEFFQSQLNQVQINQILQQLVSANEIFSVGSDNYLLNV

Entity 4 Entity 4 polymer

Description description	Telomerase holoenzyme Teb3 subunit
Molecular weight formula_weight	14007.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MDAEQEQVMYPRILFEQMAQFRGKKVTVVGNVCNEDQNDSLVIEFGPTGLNQHVVIDNYRRVDLNNTTKFVEIRGVVLNQNIVSCEELTEFEQKDPFDFDTYSKLIHLSQSDKLSSLFTDQ

Entity 5 Entity 5 polymer

Description description	Telomerase associated protein p50
Molecular weight formula_weight	50049.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MKLLLQNQNIFQKLKNTLNGCIKKFYDTYQDLEQMQKFEMIVEDKLLFRYSCSQSEMFSAQIQAHYLEKRVLQLTDGNVKYIVNFRDKGVLDKANFFDTPNNSLVIIRQWSYEIYYTKNTFQINLVIDEMRCIDIITTIFYCKLELDFTQGIKGISKSSSFSNQIYEYSAQYYKAIQLLKKLLINDSYISELYNSTKSKQQPRLFIFQSFKPKMNLAEQNLSRQFEQCQQDDFGDGCLLQIVNYTHQSLKQIENKNNSNQIVNGQNEISKKKRVLKSNEDLYKISLQKQLKIFQEEEIELHSQSTIRNQTNQQLETFESDTSKRNSEKILHSINELNTSKQKVNQMNSSQHQIQKLENNNLNKNILNQINENDIKNELEERQQQHLTQSFNSKAQLKKIITLKKNQDILLFKPQEQEGSKKY

Entity 6 Entity 6 polymer

Description description	telomere DNA
Molecular weight formula_weight	9581.1 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C

GTTGGGGTTGGGGTTGGGGTTGGGGTTGGG

Entity 7 Entity 7 polymer

Description description	Telomerase RNA
Molecular weight formula_weight	50747.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	B

AUACCCGCUUAAUUCAUUCAGAUCUGUAAUAGAACUGUCAUUCAACCCCAAAAAUCUAGUGCUGAUAUAACCUUCACCAAUUAGGUUCAAAUAAGUGGUAAUGCGGGACAAAAGACUAUCGACAUUUGAUACACUAUUUAUCAAUGGAUGUCUUAUUUU

Entity 8 Entity 8 polymer

Description description	Telomerase La-related protein p65
Molecular weight formula_weight	64207.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDEYLENTNLEELEQECFMEDYQHEDVVEQENHQVDANDIYENQQMNDESQLNQDVKISQQKEQAVEMIEEQQQNNQDKFKQFQDCMAHITELNFKRNYQNLTEQSSSNNVVAEELDIKESLKLQMEYYFCDTNLTHDSYLRGIISKSPKNCVDIKVFLKFNKIQQILKQIQDKQIVSTYGIENQSQKKNHKNYKNQNATFSKKDLIHLIRDSLKESKILKVKMDSLKVKRRFPFNLEQALKNSKQRTLYIDFLPPKCSKQTLVSIFGNFRIININLPLQKNSQLCQGFAFIEFFSEEEANQALITKNSSIPKELILLTEKKIGQGSIRIITYKKWQEEKQSFKELSKNQNEQKNKNMNQSRKASDEFVSIDVEIKQNCLIKIINIPQGTLKAEVVLAVRHLGYEFYCDYIDENSNQINSNKISLSTQQQNTAQCSNIQIENNLIQQDQHPQLNDLLKEGQAMIRFQNSDEQRLAIQKLLNHNNNKLQIEIRGQICDVISTIPEDEEKNYWNYIKFKKNEFRKFFFMKKQQKKQNITQNYNK

Entity 9 Entity 9 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	8gapF01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	162358

Structure of LARP7 protein p65-telomerase RNA complex in telomerase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Telomerase reverse transcriptase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomerase holoenzyme Teb1 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomerase holoenzyme Teb2 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomerase holoenzyme Teb3 subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomerase associated protein p50

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Telomerase La-related protein p65

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8gap__assembly_1__model_1

8gap__assembly_1__model_1 | I(q)

8gap__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 non-polymer

6. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

7. Citations (1)