8hcr

Cryo-EM structure of the Mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome cI

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome bc1 complex Rieske iron-sulfur subunit

Mycobacterium tuberculosis variant bovis BCG

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Cytochrome bc1 complex cytochrome b subunit × 2 （A0A0K2HYC0） Cytochrome bc1 complex cytochrome c subunit × 2 （P9WP35） CYTOCHROME AA3 SUBUNIT CtaC × 2 Probable cytochrome c oxidase subunit 1 × 2 （P9WP71） Probable cytochrome c oxidase subunit 3 × 2 （P9WP67） Cytochrome c oxidase polypeptide 4 × 2 （A0A0K2HXG0） CYTOCHROME AA3 SUBUNIT CtaJ × 2 DUF5130 domain-containing protein × 2 （A0A7U4BVZ0） FE2/S2 (INORGANIC) CLUSTER × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 4 HEME-A × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A045GW18_MYCTX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–429； UniProt 1–429 Author chain M； PDBConstruct 1–429； UniProt 1–429

Cytochrome bc1 complex cytochrome b subunit

Mycobacterium tuberculosis variant bovis BCG

UniProt A0A0K2HYC0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （A0A045GW18） Cytochrome bc1 complex cytochrome c subunit × 2 （P9WP35） CYTOCHROME AA3 SUBUNIT CtaC × 2 Probable cytochrome c oxidase subunit 1 × 2 （P9WP71） Probable cytochrome c oxidase subunit 3 × 2 （P9WP67） Cytochrome c oxidase polypeptide 4 × 2 （A0A0K2HXG0） CYTOCHROME AA3 SUBUNIT CtaJ × 2 DUF5130 domain-containing protein × 2 （A0A7U4BVZ0） FE2/S2 (INORGANIC) CLUSTER × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 4 HEME-A × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0K2HYC0_MYCBI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–549； UniProt 1–549 Author chain N； PDBConstruct 1–549； UniProt 1–549

Cytochrome bc1 complex cytochrome c subunit

Mycobacterium tuberculosis variant bovis BCG

UniProt P9WP35

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （A0A045GW18） Cytochrome bc1 complex cytochrome b subunit × 2 （A0A0K2HYC0） CYTOCHROME AA3 SUBUNIT CtaC × 2 Probable cytochrome c oxidase subunit 1 × 2 （P9WP71） Probable cytochrome c oxidase subunit 3 × 2 （P9WP67） Cytochrome c oxidase polypeptide 4 × 2 （A0A0K2HXG0） CYTOCHROME AA3 SUBUNIT CtaJ × 2 DUF5130 domain-containing protein × 2 （A0A7U4BVZ0） FE2/S2 (INORGANIC) CLUSTER × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 4 HEME-A × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	QCRC_MYCTU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–280； UniProt 1–280 Author chain O； PDBConstruct 1–280； UniProt 1–280

Probable cytochrome c oxidase subunit 1

Mycobacterium tuberculosis variant bovis BCG

UniProt P9WP71

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （A0A045GW18） Cytochrome bc1 complex cytochrome b subunit × 2 （A0A0K2HYC0） Cytochrome bc1 complex cytochrome c subunit × 2 （P9WP35） CYTOCHROME AA3 SUBUNIT CtaC × 2 Probable cytochrome c oxidase subunit 3 × 2 （P9WP67） Cytochrome c oxidase polypeptide 4 × 2 （A0A0K2HXG0） CYTOCHROME AA3 SUBUNIT CtaJ × 2 DUF5130 domain-containing protein × 2 （A0A7U4BVZ0） FE2/S2 (INORGANIC) CLUSTER × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 4 HEME-A × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_MYCTU
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 1–573； UniProt 1–573 Author chain R； PDBConstruct 1–573； UniProt 1–573

Probable cytochrome c oxidase subunit 3

Mycobacterium tuberculosis variant bovis BCG

UniProt P9WP67

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （A0A045GW18） Cytochrome bc1 complex cytochrome b subunit × 2 （A0A0K2HYC0） Cytochrome bc1 complex cytochrome c subunit × 2 （P9WP35） CYTOCHROME AA3 SUBUNIT CtaC × 2 Probable cytochrome c oxidase subunit 1 × 2 （P9WP71） Cytochrome c oxidase polypeptide 4 × 2 （A0A0K2HXG0） CYTOCHROME AA3 SUBUNIT CtaJ × 2 DUF5130 domain-containing protein × 2 （A0A7U4BVZ0） FE2/S2 (INORGANIC) CLUSTER × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 4 HEME-A × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_MYCTU
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–203； UniProt 1–203 Author chain S； PDBConstruct 1–203； UniProt 1–203

Cytochrome c oxidase polypeptide 4

Mycobacterium tuberculosis variant bovis BCG

UniProt A0A0K2HXG0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （A0A045GW18） Cytochrome bc1 complex cytochrome b subunit × 2 （A0A0K2HYC0） Cytochrome bc1 complex cytochrome c subunit × 2 （P9WP35） CYTOCHROME AA3 SUBUNIT CtaC × 2 Probable cytochrome c oxidase subunit 1 × 2 （P9WP71） Probable cytochrome c oxidase subunit 3 × 2 （P9WP67） CYTOCHROME AA3 SUBUNIT CtaJ × 2 DUF5130 domain-containing protein × 2 （A0A7U4BVZ0） FE2/S2 (INORGANIC) CLUSTER × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 4 HEME-A × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0K2HXG0_MYCBI
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 1–139； UniProt 1–139 Author chain T； PDBConstruct 1–139； UniProt 1–139

DUF5130 domain-containing protein

Mycobacterium tuberculosis variant bovis BCG

UniProt A0A7U4BVZ0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 18	Cytochrome bc1 complex Rieske iron-sulfur subunit × 2 （A0A045GW18） Cytochrome bc1 complex cytochrome b subunit × 2 （A0A0K2HYC0） Cytochrome bc1 complex cytochrome c subunit × 2 （P9WP35） CYTOCHROME AA3 SUBUNIT CtaC × 2 Probable cytochrome c oxidase subunit 1 × 2 （P9WP71） Probable cytochrome c oxidase subunit 3 × 2 （P9WP67） Cytochrome c oxidase polypeptide 4 × 2 （A0A0K2HXG0） CYTOCHROME AA3 SUBUNIT CtaJ × 2 FE2/S2 (INORGANIC) CLUSTER × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 HEME C × 4 HEME-A × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7U4BVZ0_MYCBI
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 1–155； UniProt 1–155 Author chain V； PDBConstruct 1–155； UniProt 1–155

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8hcr
Deposition date deposition_date	2022-11-02
Structure title title	Cryo-EM structure of the Mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome cI
Keywords keywords	Cytochrome bcc:aa3 oxidase, Mycobacterium tuberculosis, OXIDOREDUCTASE; OXIDOREDUCTASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8hcr__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8hcr__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8hcr__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	66.18 Å
Rg (electron density)	66.84 Å
Total Rg	66.65 Å
Atom count	38845
Residues	4961
Excluded volume	701330 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8hcr__assembly_1__model_1`	octadecameric （18）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Description description	Cytochrome bc1 complex Rieske iron-sulfur subunit
Molecular weight formula_weight	46976.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,M
Atom count atom_count	38845

MSRADDDAVGVPPTCGGRSDEEERRIVPGPNPQDGAKDGAKATAVPREPDEAALAAMSNQELLALGGKLDGVRIAYKEPRWPVEGTKAEKRAERSVAVWLLLGGVFGLALLLIFLFWPWEFKAADGESDFIYSLTTPLYGLTFGLSILSIAIGAVLYQKRFIPEEISIQERHDGASREIDRKTVVANLTDAFEGSTIRRRKLIGLSFGVGMGAFGLGTLVAFAGGLIKNPWKPVVPTAEGKKAVLWTSGWTPRYQGETIYLARATGTEDGPPFIKMRPEDMDAGGMETVFPWRESDGDGTTVESHHKLQEIAMGIRNPVMLIRIKPSDLGRVVKRKGQESFNFGEFFAFTKVCSHLGCPSSLYEQQSYRILCPCHQSQFDALHFAKPIFGPAARALAQLPITIDTDGYLVANGDFVEPVGPAFWERTTT

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 2 Entity 2 polymer

Description description	Cytochrome bc1 complex cytochrome b subunit
Molecular weight formula_weight	63926.0 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,N

MSPKLSPPNIGEVLARQAEDIDTRYHPSAALRRQLNKVFPTHWSFLLGEIALYSFVVLLITGVYLTLFFDPSMVDVTYNGVYQPLRGVEMSRAYQSALDISFEVRGGLFVRQIHHWAALMFAAAIMVHLARIFFTGAFRRPRETNWVIGSLLLILAMFEGYFGYSLPDDLLSGLGLRAALSSITLGMPVIGTWLHWALFGGDFPGTILIPRLYALHILLLPGIILALIGLHLALVWFQKHTQFPGPGRTEHNVVGVRVMPVFAFKSGAFFAAIVGVLGLMGGLLQINPIWNLGPYKPSQVSAGSQPDFYMMWTEGLARIWPPWEFYFWHHTIPAPVWVAVIMGLVFVLLPAYPFLEKRFTGDYAHHNLLQRPRDVPVRTAIGAMAIAFYMVLTLAAMNDIIALKFHISLNATTWIGRIGMVILPPFVYFITYRWCIGLQRSDRSVLEHGVETGIIKRLPHGAYIELHQPLGPVDEHGHPIPLQYQGAPLPKRMNKLGSAGSPGSGSFLFADSAAEDAALREAGHAAEQRALAALREHQDSIMGSPDGEHGGGGENLYFQDYKDDDDKHHHHHH

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 3 Entity 3 polymer

Description description	Cytochrome bc1 complex cytochrome c subunit
Molecular weight formula_weight	29170.4 kDa
EC 编号 ec_number	7.1.1.8
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,O

MTKLGFTRSGGSKSGRTRRRLRRRLSGGVLLLIALTIAGGLAAVLTPTPQVAVADESSSALLRTGKQLFDTSCVSCHGANLQGVPDHGPSLIGVGEAAVYFQVSTGRMPAMRGEAQAPRKDPIFDEAQIDAIGAYVQANGGGPTVVRNPDGSIATQSLRGNDLGRGGDLFRLNCASCHNFTGKGGALSSGKYAPDLAPANEQQILTAMLTGPQNMPKFSNRQLSFEAKKDIIAYVKVATEARQPGGYLLGGFGPAPEGMAMWIIGMVAAIGLALWIGARS

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 4 Entity 4 polymer

Description description	CYTOCHROME AA3 SUBUNIT CtaC
Molecular weight formula_weight	40535.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,Q

MTPRGPGRLQRLSQCRPQRGSGGPARGLRQLALAAMLGALAVTVSGCSWSEALGIGWPEGITPEAHLNRELWIGAVIASLAVGVIVWGLIFWSAVFHRKKNTDTELPRQFGYNMPLELVLTVIPFLIISVLFYFTVVVQEKMLQIAKDPEVVIDITSFQWNWKFGYQRVNFKDGTLTYDGADPERKRAMVSKPEGKDKYGEELVGPVRGLNTEDRTYLNFDKVETLGTSTEIPVLVLPSGKRIEFQMASADVIHAFWVPEFLFKRDVMPNPVANNSVNVFQIEEIIKTGAFVGHCAEMCGTYHSMMNFEVRVVTPNDFKAYLQQRIDGKTNAEALRAINQPPLAVTTHPFDTRRGELAPQPVG

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 5 Entity 5 polymer

Description description	Probable cytochrome c oxidase subunit 1
Molecular weight formula_weight	63722.3 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,R

MTAEAPPLGELEAIRPYPARTGPKGSLVYKLITTTDHKMIGIMYCVACISFFFIGGLLALLMRTELAAPGLQFLSNEQFNQLFTMHGTIMLLFYATPIVFGFANLVLPLQIGAPDVAFPRLNAFSFWLFVFGATIGAAGFITPGGAADFGWTAYTPLTDAIHSPGAGGDLWIMGLIVAGLGTILGAVNMITTVVCMRAPGMTMFRMPIFTWNIMVTSILILIAFPLLTAALFGLAADRHLGAHIYDAANGGVLLWQHLFWFFGHPEVYIIALPFFGIVSEIFPVFSRKPIFGYTTLVYATLSIAALSVAVWAHHMFATGAVLLPFFSFMTYLIAVPTGIKFFNWIGTMWKGQLTFETPMLFSVGFMVTFLLGGLTGVLLASPPLDFHVTDSYFVVAHFHYVLFGTIVFATFAGIYFWFPKMTGRLLDERLGKLHFWLTFIGFHTTFLVQHWLGDEGMPRRYADYLPTDGFQGLNVVSTIGAFILGASMFPFVWNVFKSWRYGEVVTVDDPWGYGNSLEWATSCPPPRHNFTELPRIRSERPAFELHYPHMVERLRAEAHVGRHHDEPAMVTSS

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 6 Entity 6 polymer

Description description	Probable cytochrome c oxidase subunit 3
Molecular weight formula_weight	22435.0 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,S

MTSAVGTSGTAITSRVHSLNRPNMVSVGTIVWLSSELMFFAGLFAFYFSARAQAGGNWPPPPTELNLYQAVPVTLVLIASSFTCQMGVFAAERGDIFGLRRWYVITFLMGLFFVLGQAYEYRNLMSHGTSIPSSAYGSVFYLATGFHGLHVTGGLIAFIFLLVRTGMSKFTPAQATASIVVSYYWHFVDIVWIALFTVIYFIR

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 7 Entity 7 polymer

Description description	Cytochrome c oxidase polypeptide 4
Molecular weight formula_weight	14874.1 kDa
EC 编号 ec_number	7.1.1.9
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,T

MHIEARLFEFVAAFFVVTAVLYGVLTSMFATGGVEWAGTTALALTGGMALIVATFFRFVARRLDSRPEDYEGAEISDGAGELGFFSPHSWWPIMVALSGSVAAVGIALWLPWLIAAGVAFILASAAGLVFEYYVGPEKH

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 8 Entity 8 polymer

Description description	CYTOCHROME AA3 SUBUNIT CtaJ
Molecular weight formula_weight	8408.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,U

MSAMEIHLFFVGIPLLLVVVLSVLIWSRKGPHPATYKLSEPWTHPPILWAATDVVGSAHGGHGHDASEFTVGGGASGTW

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 9 Entity 9 polymer

Description description	DUF5130 domain-containing protein
Molecular weight formula_weight	15982.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,V

MARGDVATIEHAELPPGWVLTTSGRISGVTEPGELSVHYPFPIADLVALDDALTYSSRACQVRFAIYLGDLGRDTAARAREILGKVPTPDNAVLLAVSPNQCAIEVVYGSQVRGRGAESAAPLGVAAASSAFEQGELVDGLISAIRVLSAGIAPG

Source Source

Source organism organism	Mycobacterium tuberculosis variant bovis BCG
NCBI taxonomy ID ncbi_taxonomy_id	33892
Host organism host_organism	Mycobacterium tuberculosis variant bovis BCG

Entity 10 Entity 10 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 11 Entity 11 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 12 Entity 12 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 13 Entity 13 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.50 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	100

Cryo-EM structure of the Mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome cI

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome bc1 complex Rieske iron-sulfur subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome bc1 complex cytochrome b subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome bc1 complex cytochrome c subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable cytochrome c oxidase subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable cytochrome c oxidase subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome c oxidase polypeptide 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

DUF5130 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8hcr__assembly_1__model_1

8hcr__assembly_1__model_1 | I(q)

8hcr__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (13)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source