8hkv

Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_SULAC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AL2P； PDBConstruct 1–234； UniProt 2–235

50S ribosomal protein L3

OrganismNot specified

UniProt Q4JB40

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_SULAC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AL3P； PDBConstruct 1–339； UniProt 4–342

50S ribosomal protein L4

OrganismNot specified

UniProt Q4JB41

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_SULAC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AL4P； PDBConstruct 1–251； UniProt 9–259

50S ribosomal protein L5

OrganismNot specified

UniProt P41202

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_SULAC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AL5P； PDBConstruct 1–168； UniProt 8–175

50S ribosomal protein L6

OrganismNot specified

UniProt O05637

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_SULAC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AL6P； PDBConstruct 1–181； UniProt 4–184

50S ribosomal protein L18Ae

OrganismNot specified

UniProt P38613

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18A_SULAC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain ALX0； PDBConstruct 1–76； UniProt 4–79

50S ribosomal protein L10e

OrganismNot specified

UniProt Q4JC84

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10E_SULAC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain L10E； PDBConstruct 1–164； UniProt 4–167

50S ribosomal protein L13

OrganismNot specified

UniProt P39473

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_SULAC
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain L13P； PDBConstruct 1–140； UniProt 8–147

50S ribosomal protein L14e

OrganismNot specified

UniProt Q4JAJ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14E_SULAC
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L141； PDBConstruct 1–86； UniProt 3–88 Author chain L142； PDBConstruct 1–86； UniProt 3–88

50S ribosomal protein L14

OrganismNot specified

UniProt Q4JB50

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_SULAC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L14P； PDBConstruct 1–134； UniProt 5–138

50S ribosomal protein L15e

OrganismNot specified

UniProt Q4JB20

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15E_SULAC
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain L15E； PDBConstruct 1–169； UniProt 4–172

50S ribosomal protein L18e

OrganismNot specified

UniProt P39474

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_SULAC
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain L18E； PDBConstruct 1–112； UniProt 6–117

50S ribosomal protein L18

OrganismNot specified

UniProt O05640

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_SULAC
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain L18P； PDBConstruct 1–193； UniProt 2–194

50S ribosomal protein L19e

OrganismNot specified

UniProt O05639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL19E_SULAC
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain L19E； PDBConstruct 1–144； UniProt 2–145

50S ribosomal protein L22

OrganismNot specified

UniProt Q4JB45

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_SULAC
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain L22P； PDBConstruct 1–150； UniProt 6–155

50S ribosomal protein L23

OrganismNot specified

UniProt Q4JB42

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_SULAC
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain L23P； PDBConstruct 1–81； UniProt 2–82

50S ribosomal protein L24e

OrganismNot specified

UniProt Q4JAV2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_SULAC
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain L24E； PDBConstruct 1–54； UniProt 5–58

50S ribosomal protein L24

OrganismNot specified

UniProt O05633

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_SULAC
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain L24P； PDBConstruct 1–122； UniProt 1–122

50S ribosomal protein L29

OrganismNot specified

UniProt Q4JB47

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_SULAC
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain L29P； PDBConstruct 1–63； UniProt 2–64

50S ribosomal protein L30e

OrganismNot specified

UniProt P11522

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30E_SULAC
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain L30E； PDBConstruct 1–94； UniProt 5–98

50S ribosomal protein L30

OrganismNot specified

UniProt O05642

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_SULAC
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain L30P； PDBConstruct 1–155； UniProt 1–155

50S ribosomal protein L31e

OrganismNot specified

UniProt P38618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_SULAC
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain L31E； PDBConstruct 1–75； UniProt 42–116

50S ribosomal protein L32e

OrganismNot specified

UniProt O05638

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL32_SULAC
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain L32E； PDBConstruct 1–123； UniProt 3–125

50S ribosomal protein L34e

OrganismNot specified

UniProt O05981

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL34_SULAC
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain L34E； PDBConstruct 1–77； UniProt 3–79

50S ribosomal protein L37Ae

OrganismNot specified

UniProt Q4JB29

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4JB29_SULAC
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain L37A； PDBConstruct 1–65； UniProt 5–69

50S ribosomal protein L37e

OrganismNot specified

UniProt Q4JAZ9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_SULAC
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain L37E； PDBConstruct 1–54； UniProt 1–54

50S ribosomal protein L39e

OrganismNot specified

UniProt P13005

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_SULAC
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain L39E； PDBConstruct 1–49； UniProt 3–51

50S ribosomal protein L40E

OrganismNot specified

UniProt Q4JAP0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4JAP0_SULAC
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain L40E； PDBConstruct 1–55； UniProt 1–55

50S ribosomal protein L44e

OrganismNot specified

UniProt Q4J9B2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J9B2_SULAC
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain L44E； PDBConstruct 1–92； UniProt 1–92

50S ribosomal protein L7Ae

OrganismNot specified

UniProt Q4J8P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_SULAC
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain L7A1； PDBConstruct 1–123； UniProt 4–126 Author chain L7A2； PDBConstruct 1–123； UniProt 4–126

50S ribosomal protein L15

OrganismNot specified

UniProt O05643

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_SULAC
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain L15P； PDBConstruct 1–144； UniProt 1–144

50S ribosomal protein L21e

OrganismNot specified

UniProt Q4JB11

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_SULAC
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain L21E； PDBConstruct 1–97； UniProt 2–98

DUF2280 domain-containing protein

OrganismNot specified

UniProt Q4J9G6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） Conserved protein × 1 （Q4J953） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J9G6_SULAC
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain L45A； PDBConstruct 1–101； UniProt 1–101

Conserved protein

OrganismNot specified

UniProt Q4J953

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） 50S ribosomal protein L47A × 1 （F2Z6C4）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J953_SULAC
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain L46A； PDBConstruct 1–70； UniProt 1–70

50S ribosomal protein L47A

OrganismNot specified

UniProt F2Z6C4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 37 RNA 2	23s rRNA (2996-MER) × 1 5s rRNA (122-MER) × 1 50S ribosomal protein L2 × 1 （Q4JB43） 50S ribosomal protein L3 × 1 （Q4JB40） 50S ribosomal protein L4 × 1 （Q4JB41） 50S ribosomal protein L5 × 1 （P41202） 50S ribosomal protein L6 × 1 （O05637） 50S ribosomal protein L18Ae × 1 （P38613） 50S ribosomal protein L10e × 1 （Q4JC84） 50S ribosomal protein L13 × 1 （P39473） 50S ribosomal protein L14e × 2 （Q4JAJ9） 50S ribosomal protein L14 × 1 （Q4JB50） 50S ribosomal protein L15e × 1 （Q4JB20） 50S ribosomal protein L18e × 1 （P39474） 50S ribosomal protein L18 × 1 （O05640） 50S ribosomal protein L19e × 1 （O05639） 50S ribosomal protein L22 × 1 （Q4JB45） 50S ribosomal protein L23 × 1 （Q4JB42） 50S ribosomal protein L24e × 1 （Q4JAV2） 50S ribosomal protein L24 × 1 （O05633） 50S ribosomal protein L29 × 1 （Q4JB47） 50S ribosomal protein L30e × 1 （P11522） 50S ribosomal protein L30 × 1 （O05642） 50S ribosomal protein L31e × 1 （P38618） 50S ribosomal protein L32e × 1 （O05638） 50S ribosomal protein L34e × 1 （O05981） 50S ribosomal protein L37Ae × 1 （Q4JB29） 50S ribosomal protein L37e × 1 （Q4JAZ9） 50S ribosomal protein L39e × 1 （P13005） 50S ribosomal protein L40E × 1 （Q4JAP0） 50S ribosomal protein L44e × 1 （Q4J9B2） 50S ribosomal protein L7Ae × 2 （Q4J8P1） 50S ribosomal protein L15 × 1 （O05643） 50S ribosomal protein L21e × 1 （Q4JB11） DUF2280 domain-containing protein × 1 （Q4J9G6） Conserved protein × 1 （Q4J953）	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	F2Z6C4_SULAC
Isoform	—
PDB entities	37
Chains and sequence ranges	Author chain L47A； PDBConstruct 1–80； UniProt 1–80

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8hkv
Deposition date deposition_date	2022-11-28
Structure title title	Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
Keywords keywords	Sulfolobus acidocaldarius ribosome small subunit, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8hkv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8hkv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8hkv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	73.36 Å
Rg (electron density)	74.46 Å
Total Rg	74.44 Å
Atom count	102540
Residues	7585
Excluded volume	1586900 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8hkv__assembly_1__model_1`	39-meric （39）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (37)

Entity 1 Entity 1 polymer

Description description	23s rRNA (2996-MER)
Molecular weight formula_weight	980552.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A23S
Atom count atom_count	102540

GCCGAAGCCUCCCGGUGGAUGGCUCGGCUCGGGCACCGAAGAAGGGCGCGGCAAGCAGCGAAAUGCUCGGGUGAGGCGCAAGCAGCCGUUGACCCCGAGGUCCCCUAAUGGGAUAUCCUGCCGGGUUUCCGGCGCUCCCGGUUUAUAACUGGGAGUGGGAACCCCCCGAACGGAAACAUCUUAGUAGGGGGAGGAAAAGAAAUCAAUUGAGAUCCCCUGAGUAGGGGCGACCGAAAGGGGGACAGCCCAAACUAAACCUGCCGAUGAUAAGUCGGUGGGGAUGUGGUGUUACGACCUCUAGCCUGAGGUUCGACCUCGGCUUUCCUAACCUAUCUAGCCGAACUCCCCUGGAACGGGGGGCCAUAGAGGGUGAAAGCCCCGUAGGCUAAAGAUAGGUGGAAAGUGGCUAGAGGUAGAGUACCAUCCCCUGGUUUGGGGGUGGGAAGUUAGGGGACACGUGCCUCUAAGGCUAAAUAUGUCCCGAGACCGAUAGCAAACUAAGUACCGUGAGGGAAAGCUGAAAAGAACCCCGGAAGGGGGAGUGCAAAGAGCCUGAAACCGGGUGGUUAUACAGGGUGUGGCUCGAAAGAAGUGAACCCUUCCGAAGGAAAGGGGCGCAAGCCCUUAGUACGAGGAAGGGCGAUCGGGGUCACGCCUUUCGUCUUGAAACACGGGCCGGGGAGUUCACAUCAGUGGCGAGCUUAAGGAGAUUAUCUCCGAAGGCAUAGGGAAACCAAGUGCCCGCAGCCUAGUUUCUAGGCGAGGGGCAGGGUCUGUCAGGGCCUGAAGCCACUGAUGUGAGGCUAGAAACCGGGCGAUCUAGUCCGGGGCAGGCUGAAGGUGGGGGAAACCCCACUGGAGGGCCGAAUAGGGGUUCUGACGUGCAAUUCGUUCCCUUGACCUCGGACUAGGGGCAAAAGACCAAUCUAGCCCGGUGAUAGCUAGUUCCCCCCGAAAUGCGUCCUAGCGCAGCCUCCCUAAAGGCAGCUCGCGGGGUAGAGUGACAGAUCGGGGGCUCCAGGCGAAAGCCUGGGGCUUCCGGUCUAACUCCGAACCCACGAGCGCCGAAGAAGGGGGGAGUGGGUCACUCGGCGUAAGGUUGGGUGGCAAAAGGGGAACAACCCAGACCUGGGUUAAGGCCCCAAAGUCCCGGCUAAGUGCCAACGAAAAGGCGUCUCCAGCCUUAGACAGCGGGAAGGUGGGCCCAGCAGCAGCCAUCCUCUAAGGAGUGCGUAACAGCUCACCCGCCGAGGCUGGAGGCCCUAAAGAUUGGUCGGGGCUCAAGCCGGGCGCCGAGACCCAGGAGGGGGUCUCUACUAGAGAUCCUCUGGUAGGGGGGCGCUGUGAUGGGGUAGAAGGUGGGUCGUGAGAUCCACUGGACCCGUCACAGGUGCAGAUCCCGGCGGUAGUAACAGCGAAGGGGGGUGAGAAUCCCCCUCGCCGGAAGGGCAAGGGUUUCCCGGCAACGUUCGUCAGCCGGGAGUUAGCCGGUCCUAAGGUAGGGCCUAAUAGGUACCUACCGAAAGGGAAAGGGGUUAACAUUCCCCUGCCUCCCGGGUAGGUGCGGUAACGCAAGCCAGACUCCUGACGGAUUGGGGUAGGGAGAGUAGGACCACCGUCCUACCCAAGCACUCAAGCCCUUGGAGAGCCGUAACGGUGAGAAGAGGGCGAAGGUGUGAUGGGCCUUCCGUUAGGAGGGUUCUCCUGAUCCCUAGUCCCCAUGAAAAGGGAGUCUGGAACGAUCCCGGGAGACCGUACCUAGAACCGACACUGGUGCCCCUGGGUGAGAAGCCCAAGGCGUCUGAGGGGUAACCCAGGCUAGGGAACUCGGCAAAUUAGCCCCGUAACUUCGGGAGAAGGGGUGCCUAUCGUGGUUUAACAAAGCCACGAUAGGUCGCAGUGACCAGAGGGACCUGACUGUUUAAUAAAAACAUAGGUCCCCGCUAGCCCGAAAGGGUGUGUACGGGGGCUAAAUCCUGGCCACUGGUGGUUGGUUAAAUCCGGGUUCAACCGGGCGAAGCCCCACCGAAGGCCGGGGGUAACUCUGACCCUCUUAAGGUAGCCAAAUGCCUUGCCGGGUAAGUUCCGGCGCGCAUGAAUGGAUCAACGCGGUCCCUACUGUCCCAGCCUGGGGCCUCGUGAACGCCCUGAGCCGGUGCACAGUCCGGCAUCUCCCUACACCGAGAGAAGACCCCGUGGAGCUUCACCGCAGCCUGGCGUUGUCCCUCGGGCGUUUAUGCGUAGAGUAGGUGGGAGGGGUCGAACCUGUCCUUUCGGGGGCAGGGGACCCGAAAGUGAAACACCACCCAUGGACGCUCGAGGGACUAACCUCUCGAAAGAGAGGAACAACGUCAGGUGGGCGGUUCGGCUGGGGCGGCACUCCCGCGAAAAGAUAACACGGGAGCCCAAAGGUCGGCUCAGGCGGUACAGAACGCCGCCGUAGAGCGCAAGGGCAAAAGCCGGCCUGACGUGACCCUUCCAAGUACGGGGUCACGACGCGAAAGCGGGGCCUAGCGAACGCUCGUGCCCCCACACGUGGGGGCCGGGCAUGACAGAAAAGUUACCCCGGGGAUAACAGGGUCGUCGCGGGCGAGAGCUCACAUCGACCCCGCGGUUUGCUACAUCGAUGUCGGCUCUUCCCACCCUGGAGGUGCAGCUGCCUCCAAGGGUAGGGCUGCCCGCCCGUUAAAGGGGAGCGUGAGCUGGGUUUAGACCGUCGCGAGACAGGUCGGACUCUAAGGGUAGGGAGUGCGGACCGCUUGAGGGGAAGGAACCCCUAGUACGAGAGGAACAGGGUUCCGGGGCCUCCAGUUUACCGGUUGUCCGGUAGGGCAAUGCCGGGCAGCCGCGCCCUGAGGGGUAACCGCUGAAAGCAUCUAAGCGGGAACCCCUCCCCUAAAAGAGGCGGUCAGGCGUUAGCCGGGGCCUUCCCCUAGAAGAGGGGGUUGAUGGGGUGGGGAUGUAAGCUCCAAGGUUGUAAGACCGAGGAGUUUAGUCCGCCACUCCCAAUCAGGCUCCCCCC

Entity 2 Entity 2 polymer

Description description	5s rRNA (122-MER)
Molecular weight formula_weight	39440.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A5S

UGCCCACCCGGUCAUAGUGAGCGGGUAACACCCGGACUCGUUUCGAACCCGGAAGUUAAGCCGCUCACGUCAGAGGGGCCGUGGGAUCCGAGAGGGCCCGCAGCCUCUCUGAGCUGGGAUGG

Entity 3 Entity 3 polymer

Description description	50S ribosomal protein L2
Molecular weight formula_weight	24881.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL2P

GKKLLQQRAGRGGINFRSPSWRRVGPARYPNIEGDHKGKIIDILHNPGVTAPVVKVKLDNGLQFYIPAVQGVAVGQEISIGKNATISNGNIVEVGQLPEGTVICNVEKLKGDGGKFARAAGSYAVISGKAGNKVLIKLSSEKIVEVSQNARATVGIIAGGGFVEKPLLKAGNNYWKYRVRAVKWPVVRGVAMNAVSHPHGGGLHQSVSRPSTVSRNAPPGRKVGHIASRRTGRR

Entity 4 Entity 4 polymer

Description description	50S ribosomal protein L3
Molecular weight formula_weight	38186.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL3P

RKLSSPRRGSAGLRPRKRADEILPTPKNWPLVNLKEPKLLGFIGYKAGMTHVYMIDDKPTSPNYGKEVYTPVTIVESPPILGLALRAYHIDSKGELSVLVDYWANFEEGSLKYLKRKITSLKVDSSKMKEKLDLIQKNLNNITYMRLLVSTQPWLVPSLGKKRPEIVEIQIGGGSIQDQLNYGLSLLGKQIPVRDVFREGQLTDIIGVTKGKGFQGVIKRYSVVEFPRWHKHRKGSRKIGARGPSISTPSYVPQPGQLGFHRRTEYNKRIIKIGDNVNEINPAGGIVNYGLVKNTYLVIEGSVLGSRKRPLFLRYPIRPSWSPESAPKITYVNLASQQG

Entity 5 Entity 5 polymer

Description description	50S ribosomal protein L4
Molecular weight formula_weight	27358.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL4P

KVSVLDLKGNQLEEIELPLFFSYPVRKDLIRRVFLSEFTKSLQPKGRDPLAGKRTSALSFGINLGIARVPRVKGSGEAALAPNTVGGRLAFPPTTEKRLVEEVNLKEKKLGIISALAATADPNFVKARGHRFTSNNVPIILVDDFENISKAKEIMDILKSIGVVDDIKRVKESKGVRAGKGKMRGRRYQIAKGPLIVVSNHKSPVVESASNIPGVNVVSANLVSVIHLAPGGHPGRLTIYTKSSINILRQR

Entity 6 Entity 6 polymer

Description description	50S ribosomal protein L5
Molecular weight formula_weight	19095.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL5P

KENVMRRVVLDKVTVNIGVGESGERLQKAYQLVQELTGVKPVYTKGRKSIREFGVRKGAPIGVKATLRRQAAVEFLKKVLPAVNFRLKQSSFDNYGNVSFGIAEHVLIPGTRYDPEIGIFGMDVAITLVRPGYRTMKRKRKKASIPRRHRVTKEEAINFMKENFNVTI

Entity 7 Entity 7 polymer

Description description	50S ribosomal protein L6
Molecular weight formula_weight	20305.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AL6P

LKAAYIREEIQIPDKVKVSLENNVLKVKGPKGEVIKDFSYAKGIRIQLNEGKIILETTFADRRKKALLYSIIAHIKNMITGTINGYRYYLKVISTHFPISVKVSGDEVQVSNLIGEKNIRRAKILPGVKVTVKGEDIVVEGSDIYNVAQTAANIESSTKIVGYDRRIFSDGIYIYKKEVIG

Entity 8 Entity 8 polymer

Description description	50S ribosomal protein L18Ae
Molecular weight formula_weight	8926.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	ALX0

VKIFMVRGTAIFSASRFPTSQKFTKYVRALNEKQAIEYIYSQLGGKNKIKRYNIHIQEIKEVKEDEITDKTIRDLA

Entity 9 Entity 9 polymer

Description description	50S ribosomal protein L10e
Molecular weight formula_weight	18670.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L10E

RPGRCYRKFSGPAYTRREYIPGIPMPKITKFVMGNVNGDYDYELRLITTEKGQIRHNALEAARVIALKYLSKKLASEQNFALVVTKYPHHVIRENKMMAFAGADRLQDGMRLSFGKPIGTAARLEKLGELVMYVRVKKEHLEAAKEALKIASSKLPIRTKIEIS

Entity 10 Entity 10 polymer

Description description	50S ribosomal protein L13
Molecular weight formula_weight	15808.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L13P

VIVDATNQILGRMSTHIAKLLKSGKKVYVVNAEKAIISGPRSRVLEGYSLLFTVKTMQNPYRQGIRRPRNPINIVKRTVRGMLPKNKLGKQIYRNLKAYIGIPKELEGKSMIRFDDADVSRLKGKYITVAELSRLLGGLK

Entity 11 Entity 11 polymer

Description description	50S ribosomal protein L14e
Molecular weight formula_weight	9559.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L141,L142

AIEIGRICVKTRGREAGKKCVIVDIIDSNFVLVTGPKEINGVKRRRVNILHIEPTDKKVEINKGATDQEVKQAIEQSGLTDFIKEA

Entity 12 Entity 12 polymer

Description description	50S ribosomal protein L14
Molecular weight formula_weight	14707.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L14P

MNVLGSRKGFTPALQHNSSVVVADNSGAKEAVIIGIYGYRGVLRRVPFANIADLVMVSVRKGSPDVRKQKFKAVIVRQRMPFRRPDGTWISFEDNAVVIINPDGTPKGTEVRGPIAREAAERWPKIASVATMVI

Entity 13 Entity 13 polymer

Description description	50S ribosomal protein L15e
Molecular weight formula_weight	20179.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L15E

SMYHYIEQTWQNKDWRRSILRKRLIEWRRQPAITRIDRPTRLNRARALGYKAKQGFVMVRVRVRRGGLNKPRPNSGRRPKRMGVYGYGPSKGYRWIAEERAARKFPNLEVLGSYYVAEDGMYKYYEVIMVDYSHPVIRSDPELKWLQDSVNRKRVFRGLTSAGQKSRGL

Entity 14 Entity 14 polymer

Description description	50S ribosomal protein L18e
Molecular weight formula_weight	12747.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L18E

TNIMLRKLITSLKKQDKAIWVRVAEELEAPRRKRAYINIYKINRYSKANDIIVVPGKVLGVGNLDHPVTVVALSFSKPAKEKILRSGGKVMSLYKAIQELNDFKGKTVRLMK

Entity 15 Entity 15 polymer

Description description	50S ribosomal protein L18
Molecular weight formula_weight	21766.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L18P

TQGPNYRIKFRRRREGKTDYYTRYTYVINNAIRFVPRLTNKYVIVSVSKFDQKGDIMIAYAHSIELVKKYGWKGDTNNTPAAYLTGYLAGLRAVKSGVKAAVSDIGLFVPVKGGRIFAVIKGAIDAGLKVPVGDLGKLKDRVNGSHISAYAQKLKNENQELYNKLFSSYIQRGLDPVLLPQHFEEVLNKIKEN

Entity 16 Entity 16 polymer

Description description	50S ribosomal protein L19e
Molecular weight formula_weight	17108.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L19E

PEFQLQRRLAADIAGVGLNNIKFNPERLEEVEEALTREDIKKLIKERAVIVNPKRGISSGRLKERKHKRRSKGEGRKHGSRKGKSGARTGDKEIWINKIRKIRRYIRWLRDNNVIDKHTYRLLYKRAKGNYFKNLSDVKSYLRQ

Entity 17 Entity 17 polymer

Description description	50S ribosomal protein L22
Molecular weight formula_weight	17360.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L22P

YPILSIPEDKLAKAVIKNIDASVRDLYNVCKAIRGMNLKEAREFLNNVLEEKEALPFWRYSHGTSHRSNISRKWKVKSGRYPKKAIKYVLKLLDNAENNANSKGLDIDNLKIVHIAAHKGLVLKRYMTRAFGRSTRKYKYLSHIEVILGE

Entity 18 Entity 18 polymer

Description description	50S ribosomal protein L23
Molecular weight formula_weight	9262.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L23P

IIKEFLATEKAVKLIESQNTLTIIVNRNTTKKDIKNEVEKLFSVKVEKINTLITPKGEKKAYVKLKQEYKASDVAHKLGML

Entity 19 Entity 19 polymer

Description description	50S ribosomal protein L24e
Molecular weight formula_weight	6338.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L24E

RQCSFCGKDILPGTGLMYVRNDGSLLWFCSSKCRKSMLKLHRDPKKLKWTKSYL

Entity 20 Entity 20 polymer

Description description	50S ribosomal protein L24
Molecular weight formula_weight	14130.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L24P

MISSKPSKQRKLVYNLPNHLRYKLLTARLSEDLEKQYGIKRISIRKGDSVKLMRGSQVGYEGKVVEVDRKRGRVAIEGLTKKKADGTPVYVWVHASKVIITKLDTGDKERMDAIERKRKMRE

Entity 21 Entity 21 polymer

Description description	50S ribosomal protein L29
Molecular weight formula_weight	7378.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L29P

PLEVDELRKMDLKQLKERLNELEMQLLKLRVESRMGTLKNTASIKNTRKDIARILTVIGEKSK

Entity 22 Entity 22 polymer

Description description	50S ribosomal protein L30e
Molecular weight formula_weight	10391.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L30E

FEGELKTLLRSGKVILGTRKTLKLLKTGKVKGVVVSSTLRQDLKDDIMTFSKFSDIPIYLYKGSGYELGTLCGKPFMVSVIGIVDEGESKILEF

Entity 23 Entity 23 polymer

Description description	50S ribosomal protein L30
Molecular weight formula_weight	17819.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L30P

MNELIGVIRIRGWAATPWYIQDTLSMLRLKNAFNAMIYPKDSSIQGMLNLVSSYVTWGELNDEGLRLLVSKLEISRGKKVNEEYVKDKLNVDFQSFVESIKDGKLRLNKLDEIFSLPIRLHPPKGGFKGKVSRPFRAGGEFGYRGDKINELIRRM

Entity 24 Entity 24 polymer

Description description	50S ribosomal protein L31e
Molecular weight formula_weight	8935.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L31E

KPEKENFEMVINFRRVIMGRKTTRTKRAIKYVRYMVKRHFGAEKVIIDPLLAKAITMNGRDKIVRRVRIAVKRIG

Entity 25 Entity 25 polymer

Description description	50S ribosomal protein L32e
Molecular weight formula_weight	14328.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L32E

KPAKKNMKSPGKAIKFLRFDWDKYYRIGRQERWRKPRGIDNAIRLELKGYQPKVKIGYRTDKQIRGLHPSGLRPILVKSVKDLEAFAKGKQDVIIIISSTIGLRKRIELIKKAEELGLKIANR

Entity 26 Entity 26 polymer

Description description	50S ribosomal protein L34e
Molecular weight formula_weight	8993.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L34E

SPQQRSGSFRKVFVKLPSGKSTIHYERRKDNIARCGMCKKPLNGVKNNYTYKYSKTEKRPERVYGGYLCHKCLESLI

Entity 27 Entity 27 polymer

Description description	50S ribosomal protein L37Ae
Molecular weight formula_weight	7536.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L37A

TGIAGRFGARYGSSTRKKWKEVMERRYMPHQCPYCKTTGKVVRIASGIWYCRKCETKWAGLAYTP

Entity 28 Entity 28 polymer

Description description	50S ribosomal protein L37e
Molecular weight formula_weight	6274.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L37E

MKGTPSFGKMNKTPTHVRCRRCGRNSFNARKGYCAACGFGRSKKIRRYSWQNKK

Entity 29 Entity 29 polymer

Description description	50S ribosomal protein L39e
Molecular weight formula_weight	5861.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L39E

KHKSLGKKLRLGKALKRNSPIPAWVIIKTQAEIRFNPLRRNWRRNNLKV

Entity 30 Entity 30 polymer

Description description	50S ribosomal protein L40E
Molecular weight formula_weight	6336.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L40E

MPLTDPVKLQIVQQRVFLKKICRDCGALNSIRATKCRRCHSSNLRAKKKELPAKK

Entity 31 Entity 31 polymer

Description description	50S ribosomal protein L44e
Molecular weight formula_weight	10806.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L44E

MKVPKVIKTYCPKCKTHTEHSVSLYKGGKRRSLAEGQRRYERKNVGYGSKRKPEQKRFAKTTKKQTLVLKCQKCSYTIVKEGMRLKKLELVE

Entity 32 Entity 32 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	13351.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L7A1,L7A2

PSYVKFEVPQELADKVLEAVKKAKDSGKIKKGTNETTKAVERSQAKLVVIAEDVQPEEIVAHLPLLCEEKKIPYVYVPSKKSLGEACGLQVAAASVALMDPGEAKDLVDEIVKRVNEIKGKSS

Entity 33 Entity 33 polymer

Description description	50S ribosomal protein L15
Molecular weight formula_weight	16476.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L15P

MVVRKEKKSRKYRGYRTHGWGTKGQHRDRGAQGGRQIGMHKEKWSWTVKFGEGWYGKHGFRNPTSKLVNAIGLRKLQEYIDNDKIKIEEENGKKVVDLAKYGYDKLLGGGNLRLPLVIKVAKATEKAKERVKEIGGEIILTSSE

Entity 34 Entity 34 polymer

Description description	50S ribosomal protein L21e
Molecular weight formula_weight	11155.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L21E

VARSKGYRSKTRKLLEKKVREKGAIPKLSLLMHDYSQGEYVVVKINPSIHKGMPHRRYHGKVGLVVGKRGKAYEVKVNIGDKERVLIVRPEHLIPFN

Entity 35 Entity 35 polymer

Description description	DUF2280 domain-containing protein
Molecular weight formula_weight	11662.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L45A

MKVVKYVLTAKIDYDGKEIEIKRSFRHRKNIFEFLKNADSNLKGALSEYAKQNKVKSSDLPLNEFITCGEIEEEQGVMRTECKGKEKVSVKIEVQTQKIAK

Entity 36 Entity 36 polymer

Description description	Conserved protein
Molecular weight formula_weight	8320.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L46A

MLKHQKYVYVDIGDQKKFLKVRFLKSRSENNNPEAYVILDKISIKLPRNAKVIKYEDLPAEVKDKLKLKL

Entity 37 Entity 37 polymer

Description description	50S ribosomal protein L47A
Molecular weight formula_weight	9276.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L47A

MKISNVESKYSMKVRGQELLIEEARNEKGEKIIIFQSLTSAKLLNNEEWKENTTDAKNVEKREDLPQDVRKITGKILSLI

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.94 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	617754

Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L18Ae

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L10e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L13

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L14e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer