SAXSdb — 8hq2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disintegrin and metalloproteinase domain-containing protein 22

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 233–718	Not recorded	Leucine-rich glioma-inactivated protein 1 × 1 （O95970） CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；7.5% PEG 4000, 0.2M MAGNESIUM CHLORIDE, 0.1M HEPES PH=7.5	Resolution 2.93 Å R-free 0.291
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 233–718	Not recorded	Leucine-rich glioma-inactivated protein 1 × 1 （O95970） CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；7.5% PEG 4000, 0.2M MAGNESIUM CHLORIDE, 0.1M HEPES PH=7.5	Resolution 2.93 Å R-free 0.291

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8HQ2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3G5C Structural and biochemical studies on the ectodomain of human ADAM22 Deposited 2009-02-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 233–736（504 aa） Fragment：M, D, C and E domains	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.36 Å R-free 0.273
3G5C Structural and biochemical studies on the ectodomain of human ADAM22 Deposited 2009-02-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 233–736（504 aa） Fragment：M, D, C and E domains	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.36 Å R-free 0.273
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain K 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y31 Crystal structure of human LGI1-ADAM22 complex Deposited 2017-07-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 7.12 Å R-free 0.316
5Y31 Crystal structure of human LGI1-ADAM22 complex Deposited 2017-07-27	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 7.12 Å R-free 0.316
7CQF Crystal structure of PSD-95 PDZ3 fused with ADAM22 C-terminal peptide Deposited 2020-08-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 892–906（15 aa）	Not recorded	CL CHLORIDE ION × 1 CHT CHOLINE ION × 1 EDO 1,2-ETHANEDIOL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；0.2 M choline chloride, 0.1 M Tris-HCl (pH 7.5), 14 % (w/v) PEG 2000 MME	Resolution 1.80 Å R-free 0.205
8HPY Crystal structure of human LGI1-ADAM22 complex Deposited 2022-12-13	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；2.5M sodium chloride, 0.1M HEPES pH=7.5, 2% (w/v) Benzamidine	Resolution 5.87 Å R-free 0.343
8HPY Crystal structure of human LGI1-ADAM22 complex Deposited 2022-12-13	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；2.5M sodium chloride, 0.1M HEPES pH=7.5, 2% (w/v) Benzamidine	Resolution 5.87 Å R-free 0.343
8HQ1 Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2 Deposited 2022-12-13	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；2M SODIUM CHLORIDE, 0.1M POTASSIUM/SODIUM PHOSPHATE pH=6.2	Resolution 4.17 Å R-free 0.314
8HQ1 Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2 Deposited 2022-12-13	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；2M SODIUM CHLORIDE, 0.1M POTASSIUM/SODIUM PHOSPHATE pH=6.2	Resolution 4.17 Å R-free 0.314
8HQ1 Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2 Deposited 2022-12-13	Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；2M SODIUM CHLORIDE, 0.1M POTASSIUM/SODIUM PHOSPHATE pH=6.2	Resolution 4.17 Å R-free 0.314
8Y6B Structure of human LGI1-ADAM22 complex in space group P212121 Deposited 2024-02-02	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.8M sodium/potassium tartrate, 0.1M Tris pH=7.0, 0.2M lithium sulfate.	Resolution 3.49 Å R-free 0.277
8Y6B Structure of human LGI1-ADAM22 complex in space group P212121 Deposited 2024-02-02	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.8M sodium/potassium tartrate, 0.1M Tris pH=7.0, 0.2M lithium sulfate.	Resolution 3.49 Å R-free 0.277
8Y6B Structure of human LGI1-ADAM22 complex in space group P212121 Deposited 2024-02-02	Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 233–718（486 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.8M sodium/potassium tartrate, 0.1M Tris pH=7.0, 0.2M lithium sulfate.	Resolution 3.49 Å R-free 0.277
9KZC Cryo-EM structure of the LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex Deposited 2024-12-10	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 233–718（486 aa） Fragment：UNP RESIDUES 233-729	Not recorded	CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.78 Å
9KZT Cryo-EM structure of the 3:3 LGI1-ADAM22 complex Deposited 2024-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 233–729（497 aa） Fragment：UNP RESIDUES 233-729 Chain C 233–729（497 aa） Fragment：UNP RESIDUES 233-729 Chain E 233–729（497 aa） Fragment：UNP RESIDUES 233-729	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.79 Å

9 other PDB entries and 21 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ADA22_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–486； UniProt 233–718 Author chain B； PDBConstruct 1–486； UniProt 233–718

Leucine-rich glioma-inactivated protein 1

Homo sapiens

UniProt O95970

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 39–557	Mutation：L88N/F89A/R474Q	Disintegrin and metalloproteinase domain-containing protein 22 × 1 （Q9P0K1） CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；7.5% PEG 4000, 0.2M MAGNESIUM CHLORIDE, 0.1M HEPES PH=7.5	Resolution 2.93 Å R-free 0.291
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 39–557	Mutation：L88N/F89A/R474Q	Disintegrin and metalloproteinase domain-containing protein 22 × 1 （Q9P0K1） CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；7.5% PEG 4000, 0.2M MAGNESIUM CHLORIDE, 0.1M HEPES PH=7.5	Resolution 2.93 Å R-free 0.291

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8HQ2	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 224–557（334 aa） Fragment：UNP RESIDUES 224-557	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 224–557（334 aa） Fragment：UNP RESIDUES 224-557	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 224–557（334 aa） Fragment：UNP RESIDUES 224-557	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 224–557（334 aa） Fragment：UNP RESIDUES 224-557	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 224–557（334 aa） Fragment：UNP RESIDUES 224-557	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y2Z Crystal structure of human LGI1 EPTP-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 224–557（334 aa） Fragment：UNP RESIDUES 224-557	Not recorded	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 2.67 Å R-free 0.279
5Y30 Crystal structure of LGI1 LRR domain Deposited 2017-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 37–223（187 aa） Fragment：LGI1 LRR domain (UNP RESIDUES 37-223)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；20% PEG 4000, 0.2 M ammonium acetate, 0.1 M tri-sodium citrate (pH 5.5)	Resolution 1.78 Å R-free 0.191
5Y31 Crystal structure of human LGI1-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 37–557（521 aa） Fragment：UNP RESIDUES 37-557	Mutation：R470A	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 7.12 Å R-free 0.316
5Y31 Crystal structure of human LGI1-ADAM22 complex Deposited 2017-07-27	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 37–557（521 aa） Fragment：UNP RESIDUES 37-557	Mutation：R470A	CA CALCIUM ION × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；293 K；10 % PEG 8000, 0.1 M zinc acetate, 0.1 M MES-Na (pH 6.0)	Resolution 7.12 Å R-free 0.316
8HPY Crystal structure of human LGI1-ADAM22 complex Deposited 2022-12-13	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；2.5M sodium chloride, 0.1M HEPES pH=7.5, 2% (w/v) Benzamidine	Resolution 5.87 Å R-free 0.343
8HPY Crystal structure of human LGI1-ADAM22 complex Deposited 2022-12-13	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；293 K；2.5M sodium chloride, 0.1M HEPES pH=7.5, 2% (w/v) Benzamidine	Resolution 5.87 Å R-free 0.343
8HQ1 Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2 Deposited 2022-12-13	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；2M SODIUM CHLORIDE, 0.1M POTASSIUM/SODIUM PHOSPHATE pH=6.2	Resolution 4.17 Å R-free 0.314
8HQ1 Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2 Deposited 2022-12-13	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；2M SODIUM CHLORIDE, 0.1M POTASSIUM/SODIUM PHOSPHATE pH=6.2	Resolution 4.17 Å R-free 0.314
8HQ1 Crystal Structure Of Human Lgi1-Adam22 Complex In Space Group C2 Deposited 2022-12-13	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.2；293 K；2M SODIUM CHLORIDE, 0.1M POTASSIUM/SODIUM PHOSPHATE pH=6.2	Resolution 4.17 Å R-free 0.314
8Y6B Structure of human LGI1-ADAM22 complex in space group P212121 Deposited 2024-02-02	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.8M sodium/potassium tartrate, 0.1M Tris pH=7.0, 0.2M lithium sulfate.	Resolution 3.49 Å R-free 0.277
8Y6B Structure of human LGI1-ADAM22 complex in space group P212121 Deposited 2024-02-02	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.8M sodium/potassium tartrate, 0.1M Tris pH=7.0, 0.2M lithium sulfate.	Resolution 3.49 Å R-free 0.277
8Y6B Structure of human LGI1-ADAM22 complex in space group P212121 Deposited 2024-02-02	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 39–557（519 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；293 K；0.8M sodium/potassium tartrate, 0.1M Tris pH=7.0, 0.2M lithium sulfate.	Resolution 3.49 Å R-free 0.277
9KZC Cryo-EM structure of the LGI1 LRR-LGI1 EPTP-ADAM22 ECD complex Deposited 2024-12-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 37–557（521 aa） Fragment：UNP RESIDUES 37-557 Chain D 37–557（521 aa） Fragment：UNP RESIDUES 37-557	Mutation：R470A Mutation：R470A	CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.78 Å
9KZT Cryo-EM structure of the 3:3 LGI1-ADAM22 complex Deposited 2024-12-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 37–557（521 aa） Fragment：UNP RESIDUES 37-557 Chain D 37–557（521 aa） Fragment：UNP RESIDUES 37-557 Chain F 37–557（521 aa） Fragment：UNP RESIDUES 37-557	Mutation：R470A Mutation：R470A Mutation：R470A	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.79 Å

8 other PDB entries and 19 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LGI1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 8–526； UniProt 39–557 Author chain E； PDBConstruct 8–526； UniProt 39–557

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8hq2
Deposition date deposition_date	2022-12-13
Structure title title	Crystal structure of human ADAM22 in complex with human LGI1 mutant
Keywords keywords	SYNAPTIC MODULATOR, COMPLEX, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	56.30 Å
Radius of gyration Rg (electron density) rg_electron	56.85 Å
Forward intensity I(0) i0	769688000.00
Molecular weight molecular_weight	227910.0 kDa
Excluded volume excluded_volume	283730 Å³
Envelope volume envelope_volume	449500 Å³
Hydration-shell volume shell_volume	69447 Å³
Envelope diameter envelope_diameter	227.0 Å
Shell Rg shell_rg	55.06 Å
Envelope Rg envelope_rg	56.88 Å
Shape Rg shape_rg	56.81 Å
Total Rg total_rg	56.90 Å
Total atoms total_atoms	15958
Residues n_residues	2000
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	216.8 Å
Rg (real space) rg_real	56.76 Å
Rg uncertainty (real space) rg_real_error	3.12 Å
I(0) (real space) i0_real	7.6970e+08
I(0) uncertainty (real space) i0_real_error	1.7030e+07
Rg (reciprocal space) rg_reciprocal	55.93 Å
I(0) (reciprocal space) i0_reciprocal	768700000.0000
Solution quality estimate total_estimate	0.8182
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	69.7 Å
Skewness Skewness skewness	0.567
Kurtosis Kurtosis kurtosis	0.277
Angular range angular_range	— – 0.1400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	29510000.0000
Real-space data points n_real_points	29
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.656; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.824; Smooth: 0.838

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Disintegrin and metalloproteinase domain-containing protein 22
Molecular weight formula_weight	53743.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	16132

NVEEETKYIELMIVNDHLMFKKHRLSVVHTNTYAKSVVNMADLIYKDQLKTRIVLVAMETWATDNKFAISENPLITLREFMKYRRDFIKEKSDAVHLFSGSQFESSRSGAAYIGGICSLLKGGGVNEFGKTDLMAVTLAQSLAHNIGIISDKRKLASGECKCEDTWSGCIMGDTGYYLPKKFTQCNIEEYHDFLNSGGGACLFNKPSKLLDPPECGNGFIETGEECDCGTPAECVLEGAECCKKCTLTQDSQCSDGLCCKKCKFQPMGTVCREAVNDCDIRETCSGNSSQCAPNIHKMDGYSCDGVQGICFGGRCKTRDRQCKYIWGQKVTASDKYCYEKLNIEGTEKGNCGKDKDTWIQCNKRDVLCGYLLCTNIGNIPRLGELDGEITSTLVVQQGRTLNCSGGHVKLEEDVDLGYVEDGTPCGPQMMCLEHRCLPVASFNFSTCLSSKEGTICSGNGVCSNELKCVCNRHWIGSDCNTYFPHN

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Leucine-rich glioma-inactivated protein 1
Molecular weight formula_weight	60512.4 kDa
Mutation mutation	L88N/F89A/R474Q
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

HHHHHHHKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFNATPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSQGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	12

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	174

▶

8. Citations (1)

▶

Unit-cell length a length_a	53.250 Å
Unit-cell length b length_b	98.854 Å
Unit-cell length c length_c	131.258 Å
Unit-cell angle α angle_alpha	96.21 °
Unit-cell angle β angle_beta	100.44 °
Unit-cell angle γ angle_gamma	91.31 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.930 Å
Low-resolution limit resolution_low	45.830 Å
R factor r_factor	0.2470
R_work r_work	0.2450
R_free r_free	0.2910

fit	/app/data/saxs_computation/hq/8hq2/8hq2.fit
pddf	/app/data/pr_computation/hq/8hq2/8hq2.pr.out
profile	/app/data/saxs_computation/hq/8hq2/8hq2.dat

Crystal structure of human ADAM22 in complex with human LGI1 mutant

1. Protein Identity and Related Structures Protein Identity & Related Structures

Disintegrin and metalloproteinase domain-containing protein 22

State in the Current Structure

Other States of the Same Protein in the Database

Leucine-rich glioma-inactivated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)