SAXSdb — 8hxc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NFkB inhibitor

Monkeypox virus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain A； UniProt 18–220 Chain B； UniProt 18–220 Chain C； UniProt 18–220 Chain D； UniProt 18–220 Chain E； UniProt 18–220 Chain F； UniProt 18–220 Chain G； UniProt 18–220	Not recorded	T-lymphocyte activation antigen CD86 × 7 （P42081）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.12 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8HXC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
8HXA Cryo-EM structure of MPXV M2 in complex with human B7.1 Deposited 2023-01-04	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 18–220（203 aa） Chain B 18–220（203 aa） Chain C 18–220（203 aa） Chain D 18–220（203 aa） Chain E 18–220（203 aa） Chain F 18–220（203 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.04 Å
8HXB Cryo-EM structure of MPXV M2 hexamer in complex with human B7.2 Deposited 2023-01-04	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain A 18–220（203 aa） Chain B 18–220（203 aa） Chain C 18–220（203 aa） Chain D 18–220（203 aa） Chain E 18–220（203 aa） Chain F 18–220（203 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	Q3I8Y9_MONPV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–203； UniProt 18–220 Author chain B； PDBConstruct 1–203； UniProt 18–220 Author chain C； PDBConstruct 1–203； UniProt 18–220 Author chain D； PDBConstruct 1–203； UniProt 18–220 Author chain E； PDBConstruct 1–203； UniProt 18–220 Author chain F； PDBConstruct 1–203； UniProt 18–220 Author chain G； PDBConstruct 1–203； UniProt 18–220

T-lymphocyte activation antigen CD86

Homo sapiens

UniProt P42081

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 14 PDB declaration: tetradecameric（14） Consistent with protein copy count	Chain H； UniProt 26–238 Chain I； UniProt 26–238 Chain J； UniProt 26–238 Chain K； UniProt 26–238 Chain L； UniProt 26–238 Chain M； UniProt 26–238 Chain N； UniProt 26–238	Not recorded	NFkB inhibitor × 7 （Q3I8Y9）	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.12 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8HXC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1I85 CRYSTAL STRUCTURE OF THE CTLA-4/B7-2 COMPLEX Deposited 2001-03-12	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 26–134（109 aa） Fragment：IG V-TYPE (RECEPTOR BINDING) DOMAIN Chain B 26–134（109 aa） Fragment：IG V-TYPE (RECEPTOR BINDING) DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；298 K；PEG20K, HEPES, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 3.20 Å R-free 0.300
1NCN the receptor-binding domain of human B7-2 Deposited 2002-12-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 26–134（109 aa） Fragment：Ig V-type domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG4000, NaAC, Tris-HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.70 Å R-free 0.278
1NCN the receptor-binding domain of human B7-2 Deposited 2002-12-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 26–134（109 aa） Fragment：Ig V-type domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；PEG4000, NaAC, Tris-HCl, pH 8.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.70 Å R-free 0.278
5YXK High resolution crystal structure of Human B7-2 IgV domain in P21 space group Deposited 2017-12-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 26–134（109 aa） Fragment：Ig-like V-type Chain B 26–134（109 aa） Fragment：Ig-like V-type	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；0.1M Tris HCl pH 8.5, 2.4M Ammonium phosphate dibasic	Resolution 1.90 Å R-free 0.248
5YXK High resolution crystal structure of Human B7-2 IgV domain in P21 space group Deposited 2017-12-05	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 26–134（109 aa） Fragment：Ig-like V-type Chain D 26–134（109 aa） Fragment：Ig-like V-type	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；298 K；0.1M Tris HCl pH 8.5, 2.4M Ammonium phosphate dibasic	Resolution 1.90 Å R-free 0.248
8FXX Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (heptameric ring) Deposited 2023-01-25	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain C 26–134（109 aa） Chain E 26–134（109 aa） Chain G 26–134（109 aa） Chain H 26–134（109 aa） Chain J 26–134（109 aa） Chain L 26–134（109 aa） Chain N 26–134（109 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 21	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；150 mM Nacl, 25 mM HEPES, pH7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.26 Å
8FXY Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (hexameric ring) Deposited 2023-01-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain C 26–243（218 aa） Chain E 26–243（218 aa） Chain G 26–243（218 aa） Chain H 26–243（218 aa） Chain J 26–243（218 aa） Chain L 26–243（218 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；150 mM Nacl, 25 mM HEPES, pH7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.34 Å
8HXB Cryo-EM structure of MPXV M2 hexamer in complex with human B7.2 Deposited 2023-01-04	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain G 26–238（213 aa） Chain H 26–238（213 aa） Chain I 26–238（213 aa） Chain J 26–238（213 aa） Chain K 26–238（213 aa） Chain L 26–238（213 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.70 Å

6 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CD86_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–213； UniProt 26–238 Author chain I； PDBConstruct 1–213； UniProt 26–238 Author chain J； PDBConstruct 1–213； UniProt 26–238 Author chain K； PDBConstruct 1–213； UniProt 26–238 Author chain L； PDBConstruct 1–213； UniProt 26–238 Author chain M； PDBConstruct 1–213； UniProt 26–238 Author chain N； PDBConstruct 1–213； UniProt 26–238

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8hxc
Deposition date deposition_date	2023-01-04
Structure title title	Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2
Keywords keywords	M2, complex, immune evasion, VIRAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	61.08 Å
Radius of gyration Rg (electron density) rg_electron	60.62 Å
Forward intensity I(0) i0	894624000.00
Molecular weight molecular_weight	247770.0 kDa
Excluded volume excluded_volume	307880 Å³
Envelope volume envelope_volume	504310 Å³
Hydration-shell volume shell_volume	67324 Å³
Envelope diameter envelope_diameter	176.9 Å
Shell Rg shell_rg	68.78 Å
Envelope Rg envelope_rg	57.20 Å
Shape Rg shape_rg	60.66 Å
Total Rg total_rg	60.65 Å
Total atoms total_atoms	17374
Residues n_residues	2149
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	173.1 Å
Rg (real space) rg_real	60.87 Å
Rg uncertainty (real space) rg_real_error	1.38 Å
I(0) (real space) i0_real	8.9460e+08
I(0) uncertainty (real space) i0_real_error	1.7590e+07
Rg (reciprocal space) rg_reciprocal	61.21 Å
I(0) (reciprocal space) i0_reciprocal	895100000.0000
Solution quality estimate total_estimate	0.8295
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	106.5 Å
Skewness Skewness skewness	-0.063
Kurtosis Kurtosis kurtosis	-0.877
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	16380000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.958; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.907; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	NFkB inhibitor
Molecular weight formula_weight	23285.3 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G
Atom count atom_count	17374

VEYKNTICPPRQDYRYWYFVAELTIGVNYDINSTIIGECHMSESYIDRNANIVLTGYGLKINMTIMDTDQRFVAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTKYNSDLPESIHKSSSCDITINGSCVTCVNLETDPTKINPHYLHPKNKYLYHNSEYSMRGSYGVTFIDELNQCLLDIKELSYDICYRE

来源 Source

来源生物 organism	Monkeypox virus
NCBI Class编号 ncbi_taxonomy_id	10244
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	T-lymphocyte activation antigen CD86
Molecular weight formula_weight	24420.6 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K,L,M,N

LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELED

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.12 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	45302

fit	/app/data/saxs_computation/hx/8hxc/8hxc.fit
pddf	/app/data/pr_computation/hx/8hxc/8hxc.pr.out
profile	/app/data/saxs_computation/hx/8hxc/8hxc.dat

Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2

1. Protein Identity and Related Structures Protein Identity & Related Structures

NFkB inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

T-lymphocyte activation antigen CD86

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)