SAXSdb — 8hxc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NFkB inhibitor

Monkeypox virus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	T-lymphocyte activation antigen CD86 × 7 （P42081）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q3I8Y9_MONPV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–203； UniProt 18–220 Author chain B； PDBConstruct 1–203； UniProt 18–220 Author chain C； PDBConstruct 1–203； UniProt 18–220 Author chain D； PDBConstruct 1–203； UniProt 18–220 Author chain E； PDBConstruct 1–203； UniProt 18–220 Author chain F； PDBConstruct 1–203； UniProt 18–220 Author chain G； PDBConstruct 1–203； UniProt 18–220

T-lymphocyte activation antigen CD86

Homo sapiens

UniProt P42081

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 14	NFkB inhibitor × 7 （Q3I8Y9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CD86_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–213； UniProt 26–238 Author chain I； PDBConstruct 1–213； UniProt 26–238 Author chain J； PDBConstruct 1–213； UniProt 26–238 Author chain K； PDBConstruct 1–213； UniProt 26–238 Author chain L； PDBConstruct 1–213； UniProt 26–238 Author chain M； PDBConstruct 1–213； UniProt 26–238 Author chain N； PDBConstruct 1–213； UniProt 26–238

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8hxc
Deposition date deposition_date	2023-01-04
Structure title title	Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2
Keywords keywords	M2, complex, immune evasion, VIRAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8hxc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8hxc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8hxc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.08 Å
Rg (electron density)	60.62 Å
Total Rg	60.65 Å
Atom count	17374
Residues	2149
Excluded volume	307880 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8hxc__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	NFkB inhibitor
Molecular weight formula_weight	23285.3 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G
Atom count atom_count	17374

VEYKNTICPPRQDYRYWYFVAELTIGVNYDINSTIIGECHMSESYIDRNANIVLTGYGLKINMTIMDTDQRFVAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTKYNSDLPESIHKSSSCDITINGSCVTCVNLETDPTKINPHYLHPKNKYLYHNSEYSMRGSYGVTFIDELNQCLLDIKELSYDICYRE

Source Source

Source organism organism	Monkeypox virus
NCBI taxonomy ID ncbi_taxonomy_id	10244
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	T-lymphocyte activation antigen CD86
Molecular weight formula_weight	24420.6 kDa
Source method src_method	man
Copy count entity_count	7

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,K,L,M,N

LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELED

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.12 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	45302

Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2

1. Protein Identity and Related Structures Protein Identity & Related Structures

NFkB inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

T-lymphocyte activation antigen CD86

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8hxc__assembly_1__model_1

8hxc__assembly_1__model_1 | I(q)

8hxc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of MPXV M2 heptamer in complex with human B7.2

1. Protein Identity and Related Structures Protein Identity & Related Structures

NFkB inhibitor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

T-lymphocyte activation antigen CD86

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8hxc__assembly_1__model_1

8hxc__assembly_1__model_1 | I(q)

8hxc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)