SAXSdb — 8p8o

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;

Mycobacterium tuberculosis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	Orf20 × 3 （Q9F0J8）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	Orf20 × 3 （Q9F0J8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A045IIQ9_MYCTX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 21–174； UniProt 1–154 Author chain B； PDBConstruct 21–174； UniProt 1–154 Author chain C； PDBConstruct 21–174； UniProt 1–154 Author chain D； PDBConstruct 21–174； UniProt 1–154 Author chain E； PDBConstruct 21–174； UniProt 1–154 Author chain G； PDBConstruct 21–174； UniProt 1–154

Orf20

Staphylococcus aureus

UniProt Q9F0J8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 6	;Deoxyuridine 5'-triphosphate nucleotidohydrolase ; × 3 （A0A045IIQ9）	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	;Deoxyuridine 5'-triphosphate nucleotidohydrolase ; × 3 （A0A045IIQ9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q9F0J8_STAAU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain F； PDBConstruct 7–165； UniProt 1–159 Author chain H； PDBConstruct 7–165； UniProt 1–159 Author chain I； PDBConstruct 7–165； UniProt 1–159 Author chain J； PDBConstruct 7–165； UniProt 1–159 Author chain K； PDBConstruct 7–165； UniProt 1–159 Author chain L； PDBConstruct 7–165； UniProt 1–159

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8p8o
Deposition date deposition_date	2023-06-02
Last revision last_revision	2024-11-27
Structure title title	M. tuberculosis dUTPase - Stl1-159 (StlNT) complex structure
Keywords keywords	complex, inhibition, HYDROLASE; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8p8o__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8p8o__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8p8o__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	31.05 Å
Rg (electron density)	29.94 Å
Total Rg	30.48 Å
Atom count	6021
Residues	822
Excluded volume	106460 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8p8o__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8p8o__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;
Molecular weight formula_weight	17992.3 kDa
EC 编号 ec_number	3.6.1.23
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,G
Atom count atom_count	11820

MGSSHHHHHHSSGLVPRGSHMSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL

Source Source

Source organism organism	Mycobacterium tuberculosis
NCBI taxonomy ID ncbi_taxonomy_id	1773
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Orf20
Molecular weight formula_weight	19050.3 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,I,J,F,K,L

GSPEFSMEGAGQMAELPTHYGTIIKTLRKYMKLTQSKLSERTGFSQNTISNHENGNRNIGVNEIEIYGKGLGIPSYILHRISDEFKEKGYSPTLNDFGKFDKMYSYVNKAYYNDGDIYYSSYDLYDETIKLLELLKESKINVNDIDYDYVLKLYKQILSTDTEKS

Source Source

Source organism organism	Staphylococcus aureus
NCBI taxonomy ID ncbi_taxonomy_id	1280
Host organism host_organism	Escherichia coli BL21(DE3)

▶

Unit-cell length a length_a	104.669 Å
Unit-cell length b length_b	123.820 Å
Unit-cell length c length_c	170.229 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	orthorhombic

Resolution resolution	3.400 Å
Low-resolution limit resolution_low	46.380 Å
R factor r_factor	0.2467
R_work r_work	0.2439
R_free r_free	0.2856

M. tuberculosis dUTPase - Stl1-159 (StlNT) complex structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;

State in the Current Structure

Other States of the Same Protein in the Database

Orf20

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8p8o__assembly_2__model_1

8p8o__assembly_2__model_1 | I(q)

8p8o__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

M. tuberculosis dUTPase - Stl1-159 (StlNT) complex structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

;Deoxyuridine 5'-triphosphate nucleotidohydrolase ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Orf20

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8p8o__assembly_2__model_1

8p8o__assembly_2__model_1 | I(q)

8p8o__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)