SAXSdb — 8q0s

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Monellin chain B,Monellin chain A

Dioscoreophyllum cumminsii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	ACETATE ION × 2 GLYCEROL × 2 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MONA_DIOCU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 53–97； UniProt 1–45 Author chain BBB； PDBConstruct 53–97； UniProt 1–45

Monellin chain B,Monellin chain A

Dioscoreophyllum cumminsii

UniProt P02882

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Homooligomer	Protein 2	ACETATE ION × 2 GLYCEROL × 2 SODIUM ION × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MONB_DIOCU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain AAA； PDBConstruct 2–49； UniProt 1–48 Author chain BBB； PDBConstruct 2–49； UniProt 1–48

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8q0s
Deposition date deposition_date	2023-07-29
Last revision last_revision	2024-02-07
Structure title title	X-ray structure of the single chain monellin derivative MNEI
Keywords keywords	protein aggregation, functional amyloids, monellin, MNEI, protein fibrils, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8q0s__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8q0s__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8q0s__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.02 Å
Rg (electron density)	17.80 Å
Total Rg	18.76 Å
Atom count	1625
Residues	193
Excluded volume	29084 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8q0s__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Monellin chain B,Monellin chain A
Molecular weight formula_weight	11419.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AAA,BBB
Atom count atom_count	2103

MGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENEGFREIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP

Source Source

Source organism organism	Dioscoreophyllum cumminsii
Common name common_name	serendipity berry
NCBI taxonomy ID ncbi_taxonomy_id	3457
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	263

▶

Unit-cell length a length_a	31.650 Å
Unit-cell length b length_b	38.970 Å
Unit-cell length c length_c	44.130 Å
Unit-cell angle α angle_alpha	106.00 °
Unit-cell angle β angle_beta	109.52 °
Unit-cell angle γ angle_gamma	103.36 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	1.190 Å
Low-resolution limit resolution_low	38.390 Å
R factor r_factor	—
R_work r_work	0.2161
R_free r_free	0.2562

X-ray structure of the single chain monellin derivative MNEI

1. Protein Identity and Related Structures Protein Identity & Related Structures

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8q0s__assembly_1__model_1

8q0s__assembly_1__model_1 | I(q)

8q0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

X-ray structure of the single chain monellin derivative MNEI

1. Protein Identity and Related Structures Protein Identity & Related Structures

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8q0s__assembly_1__model_1

8q0s__assembly_1__model_1 | I(q)

8q0s__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)