SAXSdb — 1krl

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MONELLIN, CHAIN A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MONELLIN, CHAIN B × 1 （P02882） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	MONELLIN, CHAIN B × 1 （P02882） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MONA_DIOCU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–44； UniProt 2–45 Author chain C； PDBConstruct 1–44； UniProt 2–45

MONELLIN, CHAIN B

Dioscoreophyllum cumminsii

UniProt P02882

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	MONELLIN, CHAIN A × 1 （P02881） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	MONELLIN, CHAIN A × 1 （P02881） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MONB_DIOCU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–50； UniProt 1–50 Author chain D； PDBConstruct 1–50； UniProt 1–50

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1krl
Deposition date deposition_date	2002-01-10
Structure title title	Crystal Structure of Racemic DL-monellin in P-1
Keywords keywords	alpha-beta, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1krl__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1krl__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1krl__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.42 Å
Rg (electron density)	13.25 Å
Total Rg	14.54 Å
Atom count	766
Residues	92
Excluded volume	13729 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1krl__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1krl__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	MONELLIN, CHAIN A
Molecular weight formula_weight	5260.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	1767

REIKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP

Entity 2 Entity 2 polymer

Description description	MONELLIN, CHAIN B
Molecular weight formula_weight	5841.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

GEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYEEN

Source Source

Source organism organism	Dioscoreophyllum cumminsii
Common name common_name	serendipity berry
NCBI taxonomy ID ncbi_taxonomy_id	3457

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	235

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1krl.1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.1 — Cystatin/monellin
Family Family family	d.17.1.1 — Monellin

Domain ID domain_id	d1krl.2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.17 — Cystatin-like
Superfamily Superfamily superfamily	d.17.1 — Cystatin/monellin
Family Family family	d.17.1.1 — Monellin

CATH v4.4 (4 domains)

Domain ID domain_id	1krlA00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	50 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	130 —

Domain ID domain_id	1krlB00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2000 —

Domain ID domain_id	1krlC00
Class class	6 — Special
Architecture architecture	20 — Other non-globular
Topology topology	50 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	130 —

Domain ID domain_id	1krlD00
Class class	6 — Special
Architecture architecture	10 — Helix non-globular
Topology topology	140 — Helix Hairpins
Homologous superfamily homologous superfamily	2000 —

▶

Unit-cell length a length_a	38.710 Å
Unit-cell length b length_b	49.070 Å
Unit-cell length c length_c	53.120 Å
Unit-cell angle α angle_alpha	90.55 °
Unit-cell angle β angle_beta	94.33 °
Unit-cell angle γ angle_gamma	90.31 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P -1
Space-group number int_tables_number	2
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	6.000 Å
R factor r_factor	—
R_work r_work	0.2490
R_free r_free	0.2930

Crystal Structure of Racemic DL-monellin in P-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

MONELLIN, CHAIN A

State in the Current Structure

Other States of the Same Protein in the Database

MONELLIN, CHAIN B

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1krl__assembly_1__model_1

1krl__assembly_1__model_1 | I(q)

1krl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal Structure of Racemic DL-monellin in P-1

1. Protein Identity and Related Structures Protein Identity & Related Structures

MONELLIN, CHAIN A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

MONELLIN, CHAIN B

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1krl__assembly_1__model_1

1krl__assembly_1__model_1 | I(q)

1krl__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (2 domains)

CATH v4.4 (4 domains)

7. Citations (1)