SAXSdb — 8qa9

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcriptional repressor protein KorB

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 4 DNA 2	TrfB transcriptional repressor protein × 2 （P03052） ;DNA (5'-D(TPGPTPTPTPAPGPCPTPAPAPAPCPA)-3') ; × 2 SULFATE ION × 5 water × 5	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KORB2_ECOLX
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–224； UniProt 31–253 Author chain B； PDBConstruct 2–224； UniProt 31–253

TrfB transcriptional repressor protein

Escherichia coli

UniProt P03052

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Heteromer	Protein 4 DNA 2	Transcriptional repressor protein KorB × 2 （P07674） ;DNA (5'-D(TPGPTPTPTPAPGPCPTPAPAPAPCPA)-3') ; × 2 SULFATE ION × 5 water × 5	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KORA2_ECOLX
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–101； UniProt 1–101 Author chain D； PDBConstruct 1–101； UniProt 1–101

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qa9
Deposition date deposition_date	2023-08-22
Structure title title	Crystal structure of the RK2 plasmid encoded co-complex of the C-terminally truncated transcriptional repressor protein KorB complexed with the partner repressor protein KorA bound to OA-DNA
Keywords keywords	multi-drug resistance, ParABS, clamp, CTP switch, DNA segregation, gene expression regulation, DNA BINDING PROTEIN; DNA BINDING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qa9__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qa9__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qa9__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.39 Å
Rg (electron density)	35.70 Å
Total Rg	36.12 Å
Atom count	5535
Residues	659
Excluded volume	96112 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qa9__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Transcriptional repressor protein KorB
Molecular weight formula_weight	26418.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	5584

MLDSIGDLSSLLDAPAASQGGSGPIELDLDLIDEDPHQPRTADNPGFSPESIAEIGATIKERGVKSPISVRENQEQPGRYIINHGARRYRGSKWAGKKSIPAFIDNDYNEADQVIENLQRNELTPREIADFIGRELAKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPEEVEAWLDDDTQEITRGTVKLLREFLDEKKLAAALEHHHHHH

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	TrfB transcriptional repressor protein
Molecular weight formula_weight	12850.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

MKKRLTESQFQEAIQGLEVGQQTIEIARGVLVDGKPQATFATSLGLTRGAVSQAVHRVWAAFEDKNLPEGYARVTAVLPEHQAYIVRKWEADAKKKQETKRKLAAALEHHHHHH

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 polymer

Description description	;DNA (5'-D(TPGPTPTPTPAPGPCPTPAPAPAPCPA)-3') ;
Molecular weight formula_weight	4278.8 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E,F

TGTTTAGCTAAACA

Entity 4 Entity 4 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	19

▶

Unit-cell length a length_a	173.253 Å
Unit-cell length b length_b	77.095 Å
Unit-cell length c length_c	84.609 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	107.42 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	82.650 Å
R factor r_factor	0.1940
R_work r_work	0.1910
R_free r_free	0.2524

Crystal structure of the RK2 plasmid encoded co-complex of the C-terminally truncated transcriptional repressor protein KorB complexed with the partner repressor protein KorA bound to OA-DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcriptional repressor protein KorB

State in the Current Structure

Other States of the Same Protein in the Database

TrfB transcriptional repressor protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qa9__assembly_1__model_1

8qa9__assembly_1__model_1 | I(q)

8qa9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of the RK2 plasmid encoded co-complex of the C-terminally truncated transcriptional repressor protein KorB complexed with the partner repressor protein KorA bound to OA-DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transcriptional repressor protein KorB

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

TrfB transcriptional repressor protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qa9__assembly_1__model_1

8qa9__assembly_1__model_1 | I(q)

8qa9__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)