8qcf

yeast cytoplasmic exosome-Ski2 complex degrading a RNA substrate

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Exosome complex component RRP45

Saccharomyces cerevisiae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRP45_YEAST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain B； PDBConstruct 1–305； UniProt 1–305

Exosome complex component SKI6

Saccharomyces cerevisiae

UniProt P46948

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRP41_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 4–249； UniProt 1–246

Exosome complex component RRP43

Saccharomyces cerevisiae

UniProt P25359

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRP43_YEAST
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–394； UniProt 1–394

RRP46 isoform 1

Saccharomyces cerevisiae

UniProt A0A6A5PYM9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A6A5PYM9_YEASX
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain E； PDBConstruct 4–226； UniProt 1–223

Exosome complex component RRP42

Saccharomyces cerevisiae

UniProt Q12277

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRP42_YEAST
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain F； PDBConstruct 4–268； UniProt 1–265

Exosome complex component MTR3

Saccharomyces cerevisiae

UniProt P48240

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MTR3_YEAST
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain G； PDBConstruct 1–250； UniProt 1–250

Exosome complex component RRP40

Saccharomyces cerevisiae

UniProt Q08285

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRP40_YEAST
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain H； PDBConstruct 5–244； UniProt 1–240

Exosome complex component RRP4

Saccharomyces cerevisiae

UniProt P38792

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRP4_YEAST
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain I； PDBConstruct 6–364； UniProt 1–359

Exosome complex component CSL4

Saccharomyces cerevisiae

UniProt P53859

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSL4_YEAST
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain J； PDBConstruct 4–295； UniProt 1–292

Exosome complex exonuclease DIS3

Saccharomyces cerevisiae

UniProt Q08162

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Superkiller protein 7 × 1 （Q08491） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RRP44_YEAST
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain K； PDBConstruct 5–1005； UniProt 1–1001

Superkiller protein 7

Saccharomyces cerevisiae

UniProt Q08491

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Antiviral helicase SKI2 × 1 （P35207） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SKI7_YEAST
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain L； PDBConstruct 107–345； UniProt 1–239

Antiviral helicase SKI2

Saccharomyces cerevisiae

UniProt P35207

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 12 RNA 1	Exosome complex component RRP45 × 1 （Q05636） Exosome complex component SKI6 × 1 （P46948） Exosome complex component RRP43 × 1 （P25359） RRP46 isoform 1 × 1 （A0A6A5PYM9） Exosome complex component RRP42 × 1 （Q12277） Exosome complex component MTR3 × 1 （P48240） Exosome complex component RRP40 × 1 （Q08285） Exosome complex component RRP4 × 1 （P38792） Exosome complex component CSL4 × 1 （P53859） Exosome complex exonuclease DIS3 × 1 （Q08162） Superkiller protein 7 × 1 （Q08491） ;RNA (5'hairpin 60U) ; × 1 ADENOSINE-5'-TRIPHOSPHATE × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SKI2_YEAST
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain M； PDBConstruct 1–854； UniProt 1–851

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qcf
Deposition date deposition_date	2023-08-25
Structure title title	yeast cytoplasmic exosome-Ski2 complex degrading a RNA substrate
Keywords keywords	Helicase, RNA binding, RNA degradation, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qcf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qcf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qcf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	54.98 Å
Rg (electron density)	54.93 Å
Total Rg	54.84 Å
Atom count	30751
Residues	3944
Excluded volume	547580 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qcf__assembly_1__model_1`	13-meric （13）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	Exosome complex component RRP45
Molecular weight formula_weight	34001.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B
Atom count atom_count	30751

MAKDIEISASESKFILEALRQNYRLDGRSFDQFRDVEITFGKEFGDVSVKMGNTKVHCRISCQIAQPYEDRPFEGLFVISTEISPMAGSQFENGNITGEDEVLCSRIIEKSVRRSGALDVEGLCIVAGSKCWAVRADVHFLDCDGGFIDASCIAVMAGLMHFKKPDITVHGEQIIVHPVNEREPVPLGILHIPICVTFSFFNPQDTEENIKGETNSEISIIDATLKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALTLMKCCHEAYSIIEKITDQILQLLKEDSEKRNKYAAMLTSENAREI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Exosome complex component SKI6
Molecular weight formula_weight	27892.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GPHMSRLEIYSPEGLRLDGRRWNELRRFESSINTHPHAADGSSYMEQGNNKIITLVKGPKEPRLKSQMDTSKALLNVSVNITKFSKFERSKSSHKNERRVLEIQTSLVRMFEKNVMLNIYPRTVIDIEIHVLEQDGGIMGSLINGITLALIDAGISMFDYISGISVGLYDTTPLLDTNSLEENAMSTVTLGVVGKSEKLSLLLVEDKIPLDRLENVLAIGIAGAHRVRDLMDEELRKHAQKRVSNASAR

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Exosome complex component RRP43
Molecular weight formula_weight	44109.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAESTTLETIEIHPITFPPEVLARISPELSLQRHLSLGIRPCLRKYEEFRDVAIENNTLSRYADAGNIDTKNNILGSNVLKSGKTIVITSITGGIIEETSASIKDLDDFGEEELFEVTKEEDIIANYASVYPVVEVERGRVGACTDEEMTISQKLHDSILHSRILPKKALKVKAGVRSANEDGTFSVLYPDELEDDTLNETNLKMKRKWSYVLYAKIVVLSRTGPVFDLCWNSLMYALQSVKLPRAFIDERASDLRMTIRTRGRSATIRETYEIICDQTKSVPLMINAKNIAFASNYGIVELDPECQLQNSDNSEEEEVDIDMDKLNTVLIADLDTEAEETSIHSTISILAAPSGNYKQLTLMGGGAKITPEMIKRSLLLSRVRADDLSTRFNI

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	RRP46 isoform 1
Molecular weight formula_weight	24659.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

AASMSVQAEIGILDHVDGSSEFVSQDTKVICSVTGPIEPKARQELPTQLALEIIVRPAKGVATTREKVLEDKLRAVLTPLITRHCYPRQLCQITCQILESGEDEAEFSLRELSCCINAAFLALVDAGIALNSMCASIPIAIIKDTSDIIVDPTAEQLKISLSVHTLALEFVNGGKVVKNVLLLDSNGDFNEDQLFSLLELGEQKCQELVTNIRRIIQDNISPRLVV

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 polymer

Description description	Exosome complex component RRP42
Molecular weight formula_weight	29391.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

GPHMSLSVAEKSYLYDSLASTPSIRPDGRLPHQFRPIEIFTDFLPSSNGSSRIIASDGSECIVSIKSKVVDHHVENELLQVDVDIAGQRDDALVVETITSLLNKVLKSGSGVDSSKLQLTKKYSFKIFVDVLVISSHSHPISLISFAIYSALNSTYLPKLISAFDDLEVEELPTFHDYDMVKLDINPPLVFILAVVGNNMLLDPAANESEVANNGLIISWSNGKITSPIRSVALNDSNVKSFKPHLLKQGLAMVEKYAPDVVRSLENL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 6 Entity 6 polymer

Description description	Exosome complex component MTR3
Molecular weight formula_weight	27573.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MNVQDRRRLLGPAAAKPMAFSNTTTHVPEKKSTDLTPKGNESEQELSLHTGFIENCNGSALVEARSLGHQTSLITAVYGPRSIRGSFTSQGTISIQLKNGLLEKYNTNELKEVSSFLMGIFNSVVNLSRYPKSGIDIFVYLTYDKDLTNNPQDDDSQSKMTSSQISSLIPHCITSITLALADAGIELVDMAGAGEANGTVVSFIKNGEEIVGFWKDDGDDEDLLECLDRCKEQYNRYRDLMISCLMNQET

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 7 Entity 7 polymer

Description description	Exosome complex component RRP40
Molecular weight formula_weight	26939.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

GPDSMSTFIFPGDSFPVDPTTPVKLGPGIYCDPNTQEIRPVNTGVLHVSAKGKSGVQTAYIDYSSKRYIPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVGDLVYARVCTAEKELEAEIECFDSTTGRDAGFGILEDGMIIDVNLNFARQLLFNNDFPLLKVLAAHTKFEVAIGLNGKIWVKCEELSNTLACYRTIMECCQKNDTAAFKDIAKRQFKEILTVKEE

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 8 Entity 8 polymer

Description description	Exosome complex component RRP4
Molecular weight formula_weight	39929.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

TGGRSMSEVITITKRNGAFQNSSNLSYNNTGISDDENDEEDIYMHDVNSASKSESDSQIVTPGELVTDDPIWMRGHGTYFLDNMTYSSVAGTVSRVNRLLSVIPLKGRYAPETGDHVVGRIAEVGNKRWKVDIGGKQHAVLMLGSVNLPGGILRRKSESDELQMRSFLKEGDLLNAEVQSLFQDGSASLHTRSLKYGKLRNGMFCQVPSSLIVRAKNHTHNLPGNITVVLGVNGYIWLRKTSQMDLARDTPSANNSSSIKSTGPTGAVSLNPSITRLEEESSWQIYSDENDPSISNNIRQAICRYANVIKALAFCEIGITQQRIVSAYEASMVYSNVGELIEKNVMESIGSDILTAEKMRGNGN

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 9 Entity 9 polymer

Description description	Exosome complex component CSL4
Molecular weight formula_weight	31911.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

GPHMACNFQFPEIAYPGKLICPQYGTENKDGEDIIFNYVPGPGTKLIQYEHNGRTLEAITATLVGTVRCEEEKKTDQEEEREGTDQSTEEEKSVDASPNDVTRRTVKNILVSVLPGTEKGRKTNKYANNDFANNLPKEGDIVLTRVTRLSLQRANVEILAVEDKPSPIDSGIGSNGSGIVAAGGGSGAATFSVSQASSDLGETFRGIIRSQDVRSTDRDRVKVIECFKPGDIVRAQVLSLGDGTNYYLTTARNDLGVVFARAANGAGGLMYATDWQMMTSPVTGATEKRKCAKPF

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 10 Entity 10 polymer

Description description	Exosome complex exonuclease DIS3
Molecular weight formula_weight	114214.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

GPDSMSVPAIAPRRKRLADGLSVTQKVFVRSRNGGATKIVREHYLRSDIPCLSRSCTKCPQIVVPDAQNELPKFILSDSPLELSAPIGKHYVVLDTNVVLQAIDLLENPNCFFDVIVPQIVLDEVRNKSYPVYTRLRTLCRDSDDHKRFIVFHNEFSEHTFVERLPNETINDRNDRAIRKTCQWYSEHLKPYDINVVLVTNDRLNREAATKEVESNIITKSLVQYIELLPNADDIRDSIPQMDSFDKDLERDTFSDFTFPEYYSTARVMGGLKNGVLYQGNIQISEYNFLEGSVSLPRFSKPVLIVGQKNLNRAFNGDQVIVELLPQSEWKAPSSIVLDSEHFDVNDNPDIEAGDDDDNNESSSNTTVISDKQRRLLAKDAMIAQRSKKIQPTAKVVYIQRRSWRQYVGQLAPSSVDPQSSSTQNVFVILMDKCLPKVRIRTRRAAELLDKRIVISIDSWPTTHKYPLGHFVRDLGTIESAQAETEALLLEHDVEYRPFSKKVLECLPAEGHDWKAPTKLDDPEAVSKDPLLTKRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPGTALDAEGAARGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVIWELDDSANIVNVNFMKSVIRSREAFSYEQAQLRIDDKTQNDELTMGMRALLKLSVKLKQKRLEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDAFPQTAMLRRHAAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVFNNGIVVLVPKFGVEGLIRLDNLTEDPNSAAFDEVEYKLTFVPTNSDKPRDVYVFDKVEVQVRSVMDPITSKRKAELLLK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 11 Entity 11 polymer

Description description	Superkiller protein 7
Molecular weight formula_weight	39242.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

GPDSMSAGLEVLFQGPDSATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGSGSGSGSMSLLEQLARKRIEKSKGLLSADQSHSTSKSASLLERLHKNRETKDNNAETKRKDLKTLLAKDKVKRSDFTPNQHSVSLSLKLSALKKSNSDLEKQGKSVTLDSKENELPTKRKSPDDKLNLEESWKAIKEMNHYCFLKNDPCINQTDDFAFTNFIIKDKKNSLSTSIPLSSQNSSFLSLKKHNNELLGIFVPCNLPKTTRKVAIENFNRPSPDDIIQSAQLNAFNEKLENLNIKSVGSAWSHPQFEK

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Escherichia coli

Entity 12 Entity 12 polymer

Description description	Antiviral helicase SKI2
Molecular weight formula_weight	117412.7 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MSEGFSSSSIQELYQSLKEITNNADVELFEDRITKLDFESTDEPKHANDIIKDRFLRPSNALPWSLLDMVQDVPHTSSPEDCSGKLDYKELLKVPDPINRTSYQFKRTGLEGKISGYKEEVDLKEVANANASNSLSITRSINHNQNSVRGSTAQLPFTPGGIPMKSVKTDSEQNGSSTMANATKLLHKDGQGLFDIPEGMNRGIKPMDSPAENEDQNGQFKELKQLNEIDNELDIRIEANEAKLKEEEKSAKSISEEIMEEATEETTADNADDAEIDELLPIGIDFGRTKPVSKSVPVKKEWAHVVDLNHKIENFDELIPNPARSWPFELDTFQKEAVYHLEQGDSVFVAAHTSAGKTVVAEYAIAMAHRNMTKTIYTSPIKALSNQKFRDFKETFDDVNIGLITGDVQINPDANCLIMTTEILRSMLYRGADLIRDVEFVIFDQVHYVNDQDRGVVWEEVIIMLPQHVKFILLSATVPNTYEFANWIGRTKQKNIYVISTPKRPVPLEINIWAKKELIPVINQNSEFLEANFRKHKEILNGESAKGAPSKTDNGRGGSTARGGRGGSNTRDGRGGRGNSTRGGANRGGSRGAGAIGSNKRKFFTQDGPSKKTWPEIVNYLRKRELLPMVVFVFSKKRCEEYADWLEGINFCNNKEKSQIHMFIEKSITRLKKEDRDLPQILKTRSLLERGIAVHHGGLLPIVKELIEILFSKGFIKVLFATETFAMGLNLPTRTVIFSSIRKHDGNGLRELTPGEFTQMAGRAGRRGLDSTGTVIVMAYNSPLSIATFKEVTMGVPTRLQSQFRLTYNMILNLLRIEALRVEEMIKYSFSENAGSRGLSLLPDYEKRLAVLKDTEFIDQNHNVLLKGRVACEINSGYELVLTELILDNFLGSFEPEEIVALLSVFVYEGKTREEEPPIVTPRLAKGKQRIEEIYKKMLCVFNTHQIPLTQDEAEFLDRKRFAMMNVVYEWARGLSFKEIMEMSPEAEGTVVRVITWLDEICREVKTASIIIGNSTLHMKMSRAQELIKRDIVFAASLYL

Source Source

Source organism organism	Saccharomyces cerevisiae
Common name common_name	;brewer's yeast ;
NCBI taxonomy ID ncbi_taxonomy_id	4932
Host organism host_organism	Trichoplusia ni

Entity 13 Entity 13 polymer

Description description	;RNA (5'hairpin 60U) ;
Molecular weight formula_weight	24196.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	N

CUACCCCGAGAGGGGUAGUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU

Entity 14 Entity 14 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.55 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	338757

yeast cytoplasmic exosome-Ski2 complex degrading a RNA substrate

1. Protein Identity and Related Structures Protein Identity & Related Structures

Exosome complex component RRP45

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component SKI6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP43

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RRP46 isoform 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP42

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component MTR3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP40

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component RRP4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex component CSL4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Exosome complex exonuclease DIS3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer