SAXSdb — 8qns

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis-inducing factor 1, mitochondrial

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial intermembrane space import and assembly protein 40 × 1 （Q8VEA4） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial intermembrane space import and assembly protein 40 × 1 （Q8VEA4） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial intermembrane space import and assembly protein 40 × 1 （Q8VEA4） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Mitochondrial intermembrane space import and assembly protein 40 × 1 （Q8VEA4） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	AIFM1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–512； UniProt 102–612 Author chain D； PDBConstruct 2–512； UniProt 102–612 Author chain G； PDBConstruct 2–512； UniProt 102–612 Author chain J； PDBConstruct 2–512； UniProt 102–612

Mitochondrial intermembrane space import and assembly protein 40

OrganismNot specified

UniProt Q8VEA4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Apoptosis-inducing factor 1, mitochondrial × 1 （Q9Z0X1） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Apoptosis-inducing factor 1, mitochondrial × 1 （Q9Z0X1） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Apoptosis-inducing factor 1, mitochondrial × 1 （Q9Z0X1） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Apoptosis-inducing factor 1, mitochondrial × 1 （Q9Z0X1） FLAVIN-ADENINE DINUCLEOTIDE × 1 NICOTINAMIDE-ADENINE-DINUCLEOTIDE × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MIA40_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain M； PDBConstruct 1–27； UniProt 1–27 Author chain N； PDBConstruct 1–27； UniProt 1–27 Author chain O； PDBConstruct 1–27； UniProt 1–27 Author chain P； PDBConstruct 1–27； UniProt 1–27

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8qns
Deposition date deposition_date	2023-09-27
Structure title title	Crystal structure of murine AIF bound to N-terminal domain of CHCHD4
Keywords keywords	apoptosis inducing factor, mitochondrial protein, FAD, NAD, protein complex, flavoprotein, Rossmann fold topology, PROTEIN BINDING; PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8qns__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8qns__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8qns__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.07 Å
Rg (electron density)	23.03 Å
Total Rg	23.96 Å
Atom count	3721
Residues	467
Excluded volume	66108 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8qns__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8qns__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`8qns__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`8qns__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Apoptosis-inducing factor 1, mitochondrial
Molecular weight formula_weight	57149.9 kDa
EC 编号 ec_number	1.6.99.-
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J
Atom count atom_count	14701

MGLSPEEKQRRAIASATEGGSVPQIRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTGKKVVHLDVRGNMVKLNDGSQITFEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRALEKISREVKSITVIGGGFLGSELACALGRKSQASGIEVIQLFPEKGNMGKILPQYLSNWTMEKVKREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSAPAVPQVPVEGEDYGKGVIFYLRDKVVVGIVLWNVFNRMPIARKIIKDGEQHEDLNEVAKLFNIHEDLVPRGSHHHHHH

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mitochondrial intermembrane space import and assembly protein 40
Molecular weight formula_weight	3162.5 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,N,O,P

MSYCRQEGKDRIIFVTKEDHETPSSAE

Entity 3 Entity 3 non-polymer

Description description	FLAVIN-ADENINE DINUCLEOTIDE
Molecular weight formula_weight	785.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	NICOTINAMIDE-ADENINE-DINUCLEOTIDE
Molecular weight formula_weight	663.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	86

▶

Unit-cell length a length_a	110.087 Å
Unit-cell length b length_b	115.619 Å
Unit-cell length c length_c	192.727 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.206 Å
Low-resolution limit resolution_low	99.146 Å
R factor r_factor	—
R_work r_work	0.2325
R_free r_free	0.2844

Crystal structure of murine AIF bound to N-terminal domain of CHCHD4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis-inducing factor 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Mitochondrial intermembrane space import and assembly protein 40

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qns__assembly_1__model_1

8qns__assembly_1__model_1 | I(q)

8qns__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of murine AIF bound to N-terminal domain of CHCHD4

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis-inducing factor 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mitochondrial intermembrane space import and assembly protein 40

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8qns__assembly_1__model_1

8qns__assembly_1__model_1 | I(q)

8qns__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)