8rd7

HUWE1 WWE domain in complex with ADP-ribose

Method: X-RAY DIFFRACTION D_max: 79.4 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

E3 ubiquitin-protein ligase HUWE1

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 1611–1700 Chain B； UniProt 1611–1700 Chain C； UniProt 1611–1700 Chain D； UniProt 1611–1700	Not recorded	CL CHLORIDE ION × 5 ACT ACETATE ION × 1 GOL GLYCEROL × 1 AR6 [(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL[HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGEN PHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；278 K；0.1 M Na Acetate pH 4.83, 2.9 M NaCl	Resolution 1.31 Å R-free 0.177

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8RD7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2EKK Solution structure of RUH-074, a human UBA domain Deposited 2007-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1317–1356（40 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120mM NaCl；Pressure ambient NMR sample composition 1.25mM Domain U-15N, 13C; 20mM d-Tris-HCl (pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90%H2O, 10%D2O \| 90% H2O/10% D2O	Resolution not provided
2MUL Solution Structure of the UBM1 domain of human HUWE1/ARF-BP1 Deposited 2014-09-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2951–3003（53 aa） Fragment：UNP residues 2951-3003	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 300；Pressure ambient NMR sample composition 0.4 mM [U-13C; U-15N] protein, 300 mM sodium chloride, 2.7 mM potassium chloride, 10 mM sodium phosphate, 2 mM potassium phosphate, 0.05 mM CHAPS, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3G1N Catalytic domain of the human E3 ubiquitin-protein ligase HUWE1 Deposited 2009-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 4005–4374（370 aa） Fragment：HECT DOMAIN	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；15% PEG-4000, 10% ISOPROPANOL, 0.1 M TRIS BUFFER, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.279
3G1N Catalytic domain of the human E3 ubiquitin-protein ligase HUWE1 Deposited 2009-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 4005–4374（370 aa） Fragment：HECT DOMAIN	Not recorded	NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；15% PEG-4000, 10% ISOPROPANOL, 0.1 M TRIS BUFFER, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.60 Å R-free 0.279
3H1D Structure of the HUWE1 HECT Domain Deposited 2009-04-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3993–4374（382 aa） Fragment：HECT	Mutation：C4099A, C4184A, C4367A	SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.2；291 K；0.1 M citric acid, 1.8 M (NH4)2SO4, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.89 Å R-free 0.229
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 24 PDB declaration: 24-meric	Chain B 1969–1994（26 aa） Chain D 1969–1994（26 aa） Chain F 1969–1994（26 aa） Chain H 1969–1994（26 aa） Chain J 1969–1994（26 aa） Chain L 1969–1994（26 aa） Chain N 1969–1994（26 aa） Chain P 1969–1994（26 aa） Chain R 1969–1994（26 aa） Chain T 1969–1994（26 aa） Chain V 1969–1994（26 aa） Chain X 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 11 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 12 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain V 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 13 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain X 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain N 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5C6H Mcl-1 complexed with Mule Deposited 2015-06-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain P 1969–1994（26 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277 K；PEG3350, calcium chloride	Resolution 2.05 Å R-free 0.346
5LP8 Crystal structure of an asymmetric dimer of the ubiquitin ligase HUWE1 Deposited 2016-08-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 3951–4374（424 aa） Fragment：UNP residues 3951-4374 Chain B 3951–4374（424 aa） Fragment：UNP residues 3951-4374	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Hepes pH 7, PEG20000	Resolution 2.70 Å R-free 0.225
6FYH Disulfide between ubiquitin G76C and the E3 HECT ligase Huwe1 Deposited 2018-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 4255–4374（120 aa）	Mutation：N378C	SO4 SULFATE ION × 2 ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.8M Zn SO4 0.1M Na Acetat pH 4.0	Resolution 2.91 Å R-free 0.266
6MIW WWE domain of human HUWE1 Deposited 2018-09-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1611–1700（90 aa）	Not recorded	UNX UNKNOWN LIGAND × 10 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；Molecular Dimensions Morpheus HT condition D3	Resolution 2.00 Å R-free 0.212
6PFL Crystal structure of Human HUWE1 WWE domain in complex with ADPR Deposited 2019-06-21	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1611–1700（90 aa） Chain B 1611–1700（90 aa）	Not recorded	APR ADENOSINE-5-DIPHOSPHORIBOSE × 4 UNX UNKNOWN LIGAND × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；1.4M NaCitrate, and 0.1M Tris-HCL pH7.5	Resolution 2.10 Å R-free 0.260
7JQ9 Cryo-EM structure of human HUWE1 Deposited 2020-08-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–4374（4374 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；CHAPSO detergent added to final conc. of 0.8 mM. Sample applied twice.	Resolution 3.10 Å
7MOP Cryo-EM structure of human HUWE1 in complex with DDIT4 Deposited 2021-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–4374（4374 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；CHAPSO detergent added to final conc. of 1 mM. Sample applied twice.	Resolution 3.30 Å
7MWD HUWE1 in map with focus on HECT Deposited 2021-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–4374（4374 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；CHAPSO detergent added to final conc. of 0.8 mM. Sample applied twice.	Resolution 3.70 Å
7MWE HUWE1 in map with focus on WWE Deposited 2021-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–4374（4374 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；CHAPSO detergent added to final conc. of 0.8 mM. Sample applied twice.	Resolution 3.40 Å
7MWF HUWE1 in map with focus on interface Deposited 2021-05-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–4374（4374 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；CHAPSO detergent added to final conc. of 0.8 mM. Sample applied twice.	Resolution 3.30 Å
8R7O HUWE1 WWE domain in complex with 2'F-ATP Deposited 2023-11-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1611–1700（90 aa） Chain B 1611–1700（90 aa） Chain C 1611–1700（90 aa） Chain D 1611–1700（90 aa）	Not recorded	CL CHLORIDE ION × 3 YGC [[(2~{R},3~{R},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-fluoranyl-3-oxidanyl-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] phosphono hydrogen phosphate × 2 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；278 K；0.1 M Na Acetate pH 4.83, 2.9 M NaCl	Resolution 1.36 Å R-free 0.195
8RD0 HUWE1 WWE domain in complex with compound 3 Deposited 2023-12-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1611–1700（90 aa） Chain B 1611–1700（90 aa） Chain C 1611–1700（90 aa） Chain D 1611–1700（90 aa）	Not recorded	CL CHLORIDE ION × 6 51X (1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)acetic acid × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；278 K；0.1 M Na Acetate pH 4.83, 2.9 M NaCl	Resolution 1.76 Å R-free 0.215
8RD1 HUWE1 WWE domain in complex with compound 4 Deposited 2023-12-07	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1611–1700（90 aa） Chain B 1611–1700（90 aa） Chain C 1611–1700（90 aa） Chain D 1611–1700（90 aa）	Not recorded	CL CHLORIDE ION × 5 YP2 2-(2-hydroxy-2-oxoethyl)-1,3-bis(oxidanylidene)isoindole-5-carboxylic acid × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；278 K；0.1 M Na Acetate pH 4.83, 2.9 M NaCl	Resolution 1.90 Å R-free 0.220

17 other PDB entries and 30 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	HUWE1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–91； UniProt 1611–1700 Author chain B； PDBConstruct 2–91； UniProt 1611–1700 Author chain C； PDBConstruct 2–91； UniProt 1611–1700 Author chain D； PDBConstruct 2–91； UniProt 1611–1700

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8rd7
Deposition date deposition_date	2023-12-07
Structure title title	HUWE1 WWE domain in complex with ADP-ribose
Keywords keywords	E3 Ligase, Complex, Nucleotide, LIGASE; LIGASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	22.92 Å
Radius of gyration Rg (electron density) rg_electron	21.42 Å
Forward intensity I(0) i0	26653100.00
Molecular weight molecular_weight	36202.0 kDa
Excluded volume excluded_volume	44038 Å³
Envelope volume envelope_volume	54175 Å³
Hydration-shell volume shell_volume	21593 Å³
Envelope diameter envelope_diameter	80.3 Å
Shell Rg shell_rg	27.76 Å
Envelope Rg envelope_rg	21.78 Å
Shape Rg shape_rg	21.38 Å
Total Rg total_rg	22.35 Å
Total atoms total_atoms	2537
Residues n_residues	300
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	79.4 Å
Rg (real space) rg_real	22.90 Å
Rg uncertainty (real space) rg_real_error	0.47 Å
I(0) (real space) i0_real	2.6650e+07
I(0) uncertainty (real space) i0_real_error	3.3750e+05
Rg (reciprocal space) rg_reciprocal	22.91 Å
I(0) (reciprocal space) i0_reciprocal	26650000.0000
Solution quality estimate total_estimate	0.8755
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	24.4 Å
Skewness Skewness skewness	0.308
Kurtosis Kurtosis kurtosis	-0.416
Angular range angular_range	— – 0.3450 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	8162000.0000
Real-space data points n_real_points	66
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.810; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.951; Smooth: 0.995

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	E3 ubiquitin-protein ligase HUWE1
Molecular weight formula_weight	10519.6 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	3015

GQSNSNNWRWFDDRSGRWCSYSASNNSTIDSAWKSGETSVRFTAGRRRYTVQFTTMVQVNEETGNRRPVMLTLLRVPRLNKNSKNSNGQEL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	nat
Copy count entity_count	5

Entity 3 Entity 3 non-polymer

Description description	ACETATE ION
Molecular weight formula_weight	59.0 kDa
Source method src_method	nat
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 non-polymer

Description description	;[(2R,3S,4R,5R)-5-(6-AMINOPURIN-9-YL)-3,4-DIHYDROXY-OXOLAN-2-YL]METHYL [HYDROXY-[[(2R,3S,4R,5S)-3,4,5-TRIHYDROXYOXOLAN-2-YL]METHOXY]PHOSPHORYL] HYDROGEN PHOSPHATE ;
Molecular weight formula_weight	559.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	431

▶

8. Citations (1)

▶

Unit-cell length a length_a	62.883 Å
Unit-cell length b length_b	62.883 Å
Unit-cell length c length_c	231.245 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	32

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	1.310 Å
Low-resolution limit resolution_low	44.460 Å
R factor r_factor	0.1491
R_work r_work	0.1477
R_free r_free	0.1771

fit	/app/data/saxs_computation/rd/8rd7/8rd7.fit
pddf	/app/data/pr_computation/rd/8rd7/8rd7.pr.out
profile	/app/data/saxs_computation/rd/8rd7/8rd7.dat