8rrs

Structure of mouse RyR2 solubilised in detergent in open state in complex with Ca2+, ATP, caffeine and Nb9657.

Method: ELECTRON MICROSCOPY D_max: 274.1 Å Quality: EXCELLENT

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ryanodine receptor 2

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 8 PDB declaration: octameric（8） Consistent with protein copy count	Chain A； UniProt 1–4966 Chain C； UniProt 1–4966 Chain E； UniProt 1–4966 Chain F； UniProt 1–4966	Not recorded	Nanobody 9657 × 4 ATP ADENOSINE-5'-TRIPHOSPHATE × 4 CFF CAFFEINE × 4 ZN ZINC ION × 4 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8RRS	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2MC2 X-ray crystallography-solution NMR hybrid structure of mouse RyR2 domain A Deposited 2013-08-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 10–224（215 aa） Fragment：domain A (UNP residues 10-224)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；288 K；Ionic strength (raw mmCIF value) 0.328；Pressure ambient NMR sample composition 0.4 mM [U-13C; U-15N; U-2H] RyR2, 20 mM sodium phosphate, 300 mM sodium chloride, 2 mM TCEP, 5 mM DTT, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
4ETV Crystal structure of mouse ryanodine receptor 2 (2699-2904) Deposited 2012-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2699–2904（206 aa）	Mutation：K2879A Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；295 K；9% PEG3350, 0.1M Bicine, pH 9, vapor diffusion, hanging drop, temperature 295K	Resolution 1.65 Å R-free 0.250
4ETV Crystal structure of mouse ryanodine receptor 2 (2699-2904) Deposited 2012-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2699–2904（206 aa）	Mutation：K2879A Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；295 K；9% PEG3350, 0.1M Bicine, pH 9, vapor diffusion, hanging drop, temperature 295K	Resolution 1.65 Å R-free 0.250
4ETV Crystal structure of mouse ryanodine receptor 2 (2699-2904) Deposited 2012-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2699–2904（206 aa） Chain B 2699–2904（206 aa）	Mutation：K2879A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：K2879A Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；295 K；9% PEG3350, 0.1M Bicine, pH 9, vapor diffusion, hanging drop, temperature 295K	Resolution 1.65 Å R-free 0.250
4KEI Crystal structure of mouse Ryanodine Receptor 2 (1-217) disease mutant P164S Deposited 2013-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–217（217 aa） Fragment：N-terminal domain (UNP residues 1-217)	Mutation：P164S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；294 K；0.2 M sodium malonate, 5-15% saturated ammonium sulfate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 294.0K	Resolution 2.41 Å R-free 0.273
4KEJ Crystal structure of mouse Ryanodine Receptor 2 (1-217) disease mutant R169Q Deposited 2013-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–217（217 aa） Fragment：N-terminal domain (UNP residues 1-217)	Mutation：R169Q	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；294 K；0.2 M sodium malonate, 5-15% saturated ammonium sulfate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 294.0K	Resolution 2.55 Å R-free 0.297
4KEK Crystal structure of mouse Ryanodine Receptor 2 (1-217) disease mutant R176Q Deposited 2013-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–217（217 aa） Fragment：N-terminal domain (UNP residues 1-217)	Mutation：R176Q	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；294 K；0.2 M sodium malonate, 5-15% saturated ammonium sulfate, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 294.0K	Resolution 2.15 Å R-free 0.290
4L4H Crystal structure of mouse Ryanodine Receptor isoform 2 (RyR2) 1-547 Deposited 2013-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–547（547 aa） Fragment：N-terminal domains (UNP residues 1-547)	Not recorded	CL CHLORIDE ION × 1 PGE TRIETHYLENE GLYCOL × 1 PEG DI(HYDROXYETHYL)ETHER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.15；294 K；6% PEG3350, 0.1 M Tris, pH 8.15, 0.8% ethanol, VAPOR DIFFUSION, HANGING DROP, temperature 294.0K	Resolution 2.00 Å R-free 0.251
4L4I Crystal structure of mouse Ryanodine Receptor isoform 2 (RyR2) 1-547 disease mutant R420Q Deposited 2013-06-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–547（547 aa） Fragment：N-terminal domains (UNP residues 1-547)	Mutation：R420Q	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；0.1 M Tris, pH 8.15, 5-10% PEG3350, 1% ethanol, VAPOR DIFFUSION, HANGING DROP, temperature 294.0K	Resolution 2.15 Å R-free 0.263
4P9I Crystal Structure of mouse Ryanodine Receptor 2 SPRY2 Domain (1080-1253) Deposited 2014-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1080–1253（174 aa） Fragment：UNP residues 1080-1253	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；sodium formate, peg 3350	Resolution 1.34 Å R-free 0.163
4P9I Crystal Structure of mouse Ryanodine Receptor 2 SPRY2 Domain (1080-1253) Deposited 2014-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1080–1253（174 aa） Fragment：UNP residues 1080-1253	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；sodium formate, peg 3350	Resolution 1.34 Å R-free 0.163
4P9L Crystal Structure of mouse Ryanodine Receptor 2 SPRY2 Domain (1080-1253) disease mutant A1107M Deposited 2014-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1080–1253（174 aa） Fragment：UNP Residues 1080-1253	Mutation：A1107M	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；sodium formate, peg 3350	Resolution 1.44 Å R-free 0.184
4P9L Crystal Structure of mouse Ryanodine Receptor 2 SPRY2 Domain (1080-1253) disease mutant A1107M Deposited 2014-04-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1080–1253（174 aa） Fragment：UNP Residues 1080-1253	Mutation：A1107M	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；sodium formate, peg 3350	Resolution 1.44 Å R-free 0.184
5C33 Crystal Structure of Mouse Ryanodine Receptor 2 SPRY1 Domain Deposited 2015-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 650–844（195 aa） Fragment：SPRY1 domain (UNP residues 650-844)	Non-standard monomer：Yes (specific site not provided by mmCIF)	IPA ISOPROPYL ALCOHOL × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；0.1 M sodium acetate, pH 5.0, 0.6-0.9 M sodium sulfate	Resolution 1.21 Å R-free 0.172
5C33 Crystal Structure of Mouse Ryanodine Receptor 2 SPRY1 Domain Deposited 2015-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 650–844（195 aa） Fragment：SPRY1 domain (UNP residues 650-844)	Non-standard monomer：Yes (specific site not provided by mmCIF)	IPA ISOPROPYL ALCOHOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；277 K；0.1 M sodium acetate, pH 5.0, 0.6-0.9 M sodium sulfate	Resolution 1.21 Å R-free 0.172
5VSN Crystal structure of mouse ryanodine receptor 2 SPRY2 domain (1080-1253) disease mutant P1124L Deposited 2017-05-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1084–1252（169 aa） Fragment：SPRY2 domain (UNP residues 1084-1252)	Mutation：P1124L	GOL GLYCEROL × 1 K POTASSIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.1 M potassium thiocyanate, 30% PEG2000 MME	Resolution 1.44 Å R-free 0.193
6J6L Crystal structure of mouse Ryanodine Receptor 2 SPRY1 Domain (650-844) disease mutant I784F Deposited 2019-01-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 650–844（195 aa） Chain B 650–844（195 aa）	Mutation：I784F Mutation：I784F	IPA ISOPROPYL ALCOHOL × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；0.1 M sodium acetate (PH4.5), 0.8 M sodium sulphate.	Resolution 1.45 Å R-free 0.204
6MM5 Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 peptide (2799-2810) Deposited 2018-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2799–2810（12 aa） Fragment：residues 2799-2810	Not recorded	MG MAGNESIUM ION × 1 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；277 K；0.2M trimethylamine N-oxide, 0.1 M tris-HCl, 20% (w/v) PEG monomethyl ether 2K 25% (v/V) ethylene glycol	Resolution 1.95 Å R-free 0.227
6MM6 Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 phosphorylation domain (2699-2904) Deposited 2018-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 2699–2904（206 aa） Fragment：residues 2699-2904	Mutation：K2879A	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.05M HEPES, 0.05 M KCl, 0.01M MgCl2, 15% (w/v) PEG 6K, and 25% (v/v) ethylene glycol	Resolution 2.39 Å R-free 0.261
6MM6 Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 phosphorylation domain (2699-2904) Deposited 2018-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 2699–2904（206 aa） Fragment：residues 2699-2904	Mutation：K2879A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.05M HEPES, 0.05 M KCl, 0.01M MgCl2, 15% (w/v) PEG 6K, and 25% (v/v) ethylene glycol	Resolution 2.39 Å R-free 0.261
6MM7 Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 K2879A, S2813D phosphomimetic (2699-2904) crystal form 1 Deposited 2018-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 2699–2904（206 aa） Fragment：residues 2699-2904	Mutation：K2879A, S2813D	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M magnesium formate and 25% (w/v) PEG 3350; 0.05 M HEPES, and 25% ethylene glycol	Resolution 1.85 Å R-free 0.238
6MM7 Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 K2879A, S2813D phosphomimetic (2699-2904) crystal form 1 Deposited 2018-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 2699–2904（206 aa） Fragment：residues 2699-2904	Mutation：K2879A, S2813D	EDO 1,2-ETHANEDIOL × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.1 M magnesium formate and 25% (w/v) PEG 3350; 0.05 M HEPES, and 25% ethylene glycol	Resolution 1.85 Å R-free 0.238
6MM8 Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 K2879A, S2813D phosphomimetic (2699-2904) crystal form 2 Deposited 2018-09-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2699–2904（206 aa） Fragment：residues 2699-2904	Mutation：K2879A, S2813D	PEG DI(HYDROXYETHYL)ETHER × 1 ACY ACETIC ACID × 2 ANP PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER × 1 EDO 1,2-ETHANEDIOL × 5 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；277 K；0.15 M HEPES pH 7.5, 15% (w/v) PEG 20k, and 25% (v/v) ethylene glycol	Resolution 1.85 Å R-free 0.221
6WOU Cryo-EM structure of recombinant mouse Ryanodine Receptor type 2 mutant R176Q in complex with FKBP12.6 in nanodisc Deposited 2020-04-25	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–4966（4966 aa） Chain B 1–4966（4966 aa） Chain C 1–4966（4966 aa） Chain D 1–4966（4966 aa）	Mutation：R176Q Mutation：R176Q Mutation：R176Q Mutation：R176Q	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.27 Å
6WOV Cryo-EM structure of recombinant mouse Ryanodine Receptor type 2 wild type in complex with FKBP12.6 Deposited 2020-04-25	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–4966（4966 aa） Chain B 1–4966（4966 aa） Chain C 1–4966（4966 aa） Chain D 1–4966（4966 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 5.10 Å
6Y4O Calmodulin bound to cardiac ryanodine receptor (RyR2) calmodulin binding domain Deposited 2020-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 3580–3606（27 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1 M Sodium Acetate pH 4.70 and 23 % PEG 550 MME	Resolution 1.84 Å R-free 0.208
6Y4P Calmodulin N53I variant bound to cardiac ryanodine receptor (RyR2) calmodulin binding domain Deposited 2020-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 3580–3606（27 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298.15 K；0.1 M Sodium Acetate pH 4.70 and 23 % PEG 550 MME	Resolution 2.13 Å R-free 0.246
7VML Structure of recombinant RyR2 (EGTA dataset, class 1&2, closed state) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7VMM Structure of recombinant RyR2 (EGTA dataset, class 1, closed state) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7VMN Structure of recombinant RyR2 (EGTA dataset, class 2, closed state) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Not recorded	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7VMO Structure of recombinant RyR2 (Ca2+ dataset, class 1, open state) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Not recorded	ZN ZINC ION × 4 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7VMP Structure of recombinant RyR2 (Ca2+ dataset, class 2, open state) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Not recorded	ZN ZINC ION × 4 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
7VMQ Structure of recombinant RyR2 (Ca2+ dataset, class 3, open state) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Not recorded	ZN ZINC ION × 4 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
7VMR Structure of recombinant RyR2 mutant K4593A (EGTA dataset) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593 Mutation：K4593	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
7VMS Structure of recombinant RyR2 mutant K4593A (Ca2+ dataset) Deposited 2021-10-09	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–1311（1311 aa） Chain A 1340–1386（47 aa） Chain A 1566–2507（942 aa） Chain A 2712–2915（204 aa） Chain A 3611–4966（1356 aa） Chain B 1–1311（1311 aa） Chain B 1340–1386（47 aa） Chain B 1566–2507（942 aa） Chain B 2712–2915（204 aa） Chain B 3611–4966（1356 aa） Chain C 1–1311（1311 aa） Chain C 1340–1386（47 aa） Chain C 1566–2507（942 aa） Chain C 2712–2915（204 aa） Chain C 3611–4966（1356 aa） Chain D 1–1311（1311 aa） Chain D 1340–1386（47 aa） Chain D 1566–2507（942 aa） Chain D 2712–2915（204 aa） Chain D 3611–4966（1356 aa）	Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A Mutation：K4593A	ZN ZINC ION × 4 CA CALCIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.80 Å
8DTY Recombinant mouse RyR2 triple phosphomimetic mutant S2807D/S2813D/S2030D in complex with FKBP12.6 and nanodisc under closed-state conditions Deposited 2022-07-26	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–4966（4966 aa） Chain B 1–4966（4966 aa） Chain C 1–4966（4966 aa） Chain D 1–4966（4966 aa）	Mutation：S2807D, S2813D, S2030D Mutation：S2807D, S2813D, S2030D Mutation：S2807D, S2813D, S2030D Mutation：S2807D, S2813D, S2030D	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8DTZ Recombinant mouse RyR2 triple phosphonull mutant S2807A/S2813A/S2030A in complex with FKBP12.6 and nanodisc under closed-state conditions Deposited 2022-07-26	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–4966（4966 aa） Chain B 1–4966（4966 aa） Chain C 1–4966（4966 aa） Chain D 1–4966（4966 aa）	Mutation：S2807A, S2813A, S2030A Mutation：S2807A, S2813A, S2030A Mutation：S2807A, S2813A, S2030A Mutation：S2807A, S2813A, S2030A	ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.60 Å
8DVV Recombinant mouse RyR2 triple phosphomimetic mutant S2807D/S2813D/S2030D in complex with FKBP12.6 and nanodisc under open-state conditions Deposited 2022-07-29	Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–4966（4966 aa） Chain B 1–4966（4966 aa） Chain C 1–4966（4966 aa） Chain D 1–4966（4966 aa）	Mutation：S2807D, S2813D, S2030D Mutation：S2807D, S2813D, S2030D Mutation：S2807D, S2813D, S2030D Mutation：S2807D, S2813D, S2030D	CA CALCIUM ION × 4 ZN ZINC ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.68 Å

31 other PDB entries and 38 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RYR2_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–4966； UniProt 1–4966 Author chain C； PDBConstruct 1–4966； UniProt 1–4966 Author chain E； PDBConstruct 1–4966； UniProt 1–4966 Author chain F； PDBConstruct 1–4966； UniProt 1–4966

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8rrs
Deposition date deposition_date	2024-01-23
Structure title title	Structure of mouse RyR2 solubilised in detergent in open state in complex with Ca2+, ATP, caffeine and Nb9657.
Keywords keywords	Ion channel, Ca2+, tetramer, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	106.70 Å
Forward intensity I(0) i0	50701300000.00
Molecular weight molecular_weight	1940000.0 kDa
Excluded volume excluded_volume	2432000 Å³
Envelope volume envelope_volume	4645300 Å³
Hydration-shell volume shell_volume	362850 Å³
Envelope diameter envelope_diameter	386.8 Å
Shell Rg shell_rg	104.00 Å
Envelope Rg envelope_rg	102.90 Å
Shape Rg shape_rg	106.70 Å
Total Rg total_rg	106.60 Å
Total atoms total_atoms	136400
Residues n_residues	17072
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	274.1 Å
Rg (real space) rg_real	102.00 Å
Rg uncertainty (real space) rg_real_error	0.75 Å
I(0) (real space) i0_real	4.8610e+10
I(0) uncertainty (real space) i0_real_error	9.0280e+08
Rg (reciprocal space) rg_reciprocal	106.30 Å
I(0) (reciprocal space) i0_reciprocal	50590000000.0000
Solution quality estimate total_estimate	0.9144
Solution quality rating solution_quality	EXCELLENT a EXCELLENT solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	127.9 Å
Skewness Skewness skewness	0.136
Kurtosis Kurtosis kurtosis	-0.667
Angular range angular_range	— – 0.0750 Å⁻¹
Current regularization parameter α current_alpha	0.2985
Highest regularization parameter α highest_alpha	7638000000.0000
Real-space data points n_real_points	16
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.002; Oscil: 0.999; Stabil: 0.980; Sysdev: 1.000; Positv: 1.000; Valcen: 0.956; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Ryanodine receptor 2
Molecular weight formula_weight	565536.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E,F
Atom count atom_count	136400

MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPPDLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAILLRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVSSERYLHLSYGNSSWHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGHMDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHVTTGKYLSLMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDVGVRKEVDGMGTSEIKYGDSICYIQHVDTGLWLTYQAVDVKSARMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIRSTVFLFNRFIRGLDALSKKVKLPTIDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLRALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAALIRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISLLDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIFLGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGDDLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFENFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLPKEKLKVEHSREYKQERTYTRDLLGPTVSLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIELGWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEKVKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGIQQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCSGTGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDDRAFAFDGFKAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDGFIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQVPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNNNTDIMFYRLSMPIECAEVFSKSVAGGLPGAGFYGPKNDLEDFDVDSDFEVLMKTAHGHLVPDRIDKDKETPKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTGHSARLTEDVLADDRDDYEYLMQTSTYYYSVRIFPGQEPANVWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGRNNSNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRIKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLVQCLDPLQFMSLHIPEENRSVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSHVDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLFPDENKKHGLPGIGLSTSLRPRMRFSSPSFVSISNDCYQYSPEFPLDILKAKTIQMLTEAVKEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEEEGGTPEKEISIEDAKLEGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHRIEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTREFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKKKQAEKPVASDSRKCSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRALPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVSKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLAAMEEAIKIAEDPSRDGPSPTSGSSKTLDIEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDIFKFLQISGYVVSRGFKDLDLDTPSIEKRFAYSFLQQLIRYVDEAHQYILEFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNKEKEMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVKSALRAFLDNAAEDLEKTMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPIAFLETHLDKHNVYSIYNTRSSRERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGIRYTQMPYMMEVVLPMLCSYMSRWWEHGPENHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKNRFSLKDTEEEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDPSDPERTVERVLGIANVLFHLEQKSKYTGRGYFSLVEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAELPEEDEAMKRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEKQKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDIIDEQGQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYEEFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGSAKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDLNERLANKEESEKERPEEQAPRMGFFSLLTIQSALFALRYNVLTLVRMLSLKSLKKQMKRMKKMTVKDMVLAFFSSYWSVFVTLLHFVASVCRGFFRIVSSLLLGGSLVEGAKKIKVAELLANMPDPTQDEVRGDEEEGERKPLESALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMTNPVPVPEVQEKFQEQKAKEEKEEKEETKSEPEKAEGEDGEKEEKAKDEKSKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSVVEGKELPTRTSSDTAKVTNSLDSSPHRIIAVHYVLEESSGYMEPTLRILAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN

Entity 2 Entity 2 polymer

Description description	Nanobody 9657
Molecular weight formula_weight	15125.5 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,G,I

QVQLQESGGGLMQAGGSLRLSCTASGSIFSINSMGWYRQAPGKQRELVATITSGNSINYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNADRVPNGYNPWGTPNDEYDYWGQGTQVTVSSHHHHHHEPEA

来源 Source

来源生物 organism	Vicugna pacos
NCBI Class编号 ncbi_taxonomy_id	30538
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ADENOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	CAFFEINE
Molecular weight formula_weight	194.2 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 6 Entity 6 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	4

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	76852

fit	/app/data/saxs_computation/rr/8rrs/8rrs.fit
pddf	/app/data/pr_computation/rr/8rrs/8rrs.pr.out
profile	/app/data/saxs_computation/rr/8rrs/8rrs.dat

Structure of mouse RyR2 solubilised in detergent in open state in complex with Ca2+, ATP, caffeine and Nb9657.

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ryanodine receptor 2

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)